BLASTX nr result
ID: Papaver29_contig00039944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00039944 (454 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN00797.1| Putative membrane protein [Glycine soja] 57 4e-06 ref|XP_003556197.1| PREDICTED: uncharacterized membrane protein ... 57 4e-06 ref|NP_001241089.1| uncharacterized protein LOC100789661 [Glycin... 57 4e-06 ref|XP_002271955.1| PREDICTED: uncharacterized membrane protein ... 57 5e-06 >gb|KHN00797.1| Putative membrane protein [Glycine soja] Length = 271 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 454 LYDFKTLGVLFLIGFVSIAPTILKRKRTYE 365 LYDFKTL VLFLIGFVSIAPT+LKRKR YE Sbjct: 242 LYDFKTLSVLFLIGFVSIAPTLLKRKRVYE 271 >ref|XP_003556197.1| PREDICTED: uncharacterized membrane protein At4g09580-like [Glycine max] gi|947042082|gb|KRG91806.1| hypothetical protein GLYMA_20G175400 [Glycine max] Length = 271 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 454 LYDFKTLGVLFLIGFVSIAPTILKRKRTYE 365 LYDFKTL VLFLIGFVSIAPT+LKRKR YE Sbjct: 242 LYDFKTLSVLFLIGFVSIAPTLLKRKRVYE 271 >ref|NP_001241089.1| uncharacterized protein LOC100789661 [Glycine max] gi|255639798|gb|ACU20192.1| unknown [Glycine max] gi|947086258|gb|KRH34979.1| hypothetical protein GLYMA_10G216600 [Glycine max] Length = 271 Score = 57.4 bits (137), Expect = 4e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -1 Query: 454 LYDFKTLGVLFLIGFVSIAPTILKRKRTYE 365 LYDFKTL VLFLIGFVSIAPT+LKRKR YE Sbjct: 242 LYDFKTLSVLFLIGFVSIAPTLLKRKRVYE 271 >ref|XP_002271955.1| PREDICTED: uncharacterized membrane protein At4g09580 [Vitis vinifera] gi|296081147|emb|CBI18173.3| unnamed protein product [Vitis vinifera] Length = 279 Score = 57.0 bits (136), Expect = 5e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -1 Query: 454 LYDFKTLGVLFLIGFVSIAPTILKRKRTYE 365 LYDFKTL VLFLIGF+SI PT+LKRKRTYE Sbjct: 250 LYDFKTLSVLFLIGFISILPTLLKRKRTYE 279