BLASTX nr result
ID: Papaver29_contig00039885
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00039885 (521 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004497394.1| PREDICTED: CMP-sialic acid transporter 3 [Ci... 62 2e-07 gb|KDO41336.1| hypothetical protein CISIN_1g015473mg [Citrus sin... 60 5e-07 ref|XP_006443106.1| hypothetical protein CICLE_v10020426mg [Citr... 60 5e-07 ref|XP_003592835.2| UDP-galactose transporter [Medicago truncatu... 60 8e-07 ref|XP_010057441.1| PREDICTED: CMP-sialic acid transporter 2 [Eu... 60 8e-07 ref|XP_008802376.1| PREDICTED: CMP-sialic acid transporter 2-lik... 59 1e-06 ref|XP_008802375.1| PREDICTED: CMP-sialic acid transporter 2-lik... 59 1e-06 ref|XP_008802374.1| PREDICTED: CMP-sialic acid transporter 2-lik... 59 1e-06 ref|XP_010524134.1| PREDICTED: CMP-sialic acid transporter 2 [Ta... 59 1e-06 ref|XP_013604715.1| PREDICTED: CMP-sialic acid transporter 3 [Br... 59 2e-06 ref|XP_010912808.1| PREDICTED: CMP-sialic acid transporter 2-lik... 59 2e-06 ref|XP_010912130.1| PREDICTED: CMP-sialic acid transporter 2-lik... 59 2e-06 ref|XP_010912129.1| PREDICTED: CMP-sialic acid transporter 2-lik... 59 2e-06 ref|XP_010912128.1| PREDICTED: CMP-sialic acid transporter 2-lik... 59 2e-06 ref|XP_010912126.1| PREDICTED: CMP-sialic acid transporter 2-lik... 59 2e-06 ref|XP_009383431.1| PREDICTED: CMP-sialic acid transporter 3-lik... 59 2e-06 ref|XP_009413434.1| PREDICTED: CMP-sialic acid transporter 3-lik... 59 2e-06 ref|XP_009390099.1| PREDICTED: CMP-sialic acid transporter 3-lik... 59 2e-06 ref|XP_009390098.1| PREDICTED: CMP-sialic acid transporter 3-lik... 59 2e-06 ref|XP_009116598.1| PREDICTED: CMP-sialic acid transporter 3 [Br... 59 2e-06 >ref|XP_004497394.1| PREDICTED: CMP-sialic acid transporter 3 [Cicer arietinum] Length = 403 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/40 (72%), Positives = 36/40 (90%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP G+T+L +P+ MSAY+YT IFVTVPSMASV Sbjct: 186 ISVNQLRSLPEGSTALGVPVTMSAYLYTFIFVTVPSMASV 225 >gb|KDO41336.1| hypothetical protein CISIN_1g015473mg [Citrus sinensis] Length = 406 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP G+T++ +P+AM AYIYT IF+TVPSMASV Sbjct: 186 ISVNQLRSLPEGSTAMGLPVAMGAYIYTLIFITVPSMASV 225 >ref|XP_006443106.1| hypothetical protein CICLE_v10020426mg [Citrus clementina] gi|567901238|ref|XP_006443107.1| hypothetical protein CICLE_v10020426mg [Citrus clementina] gi|568850292|ref|XP_006478849.1| PREDICTED: CMP-sialic acid transporter 3-like isoform X1 [Citrus sinensis] gi|568850294|ref|XP_006478850.1| PREDICTED: CMP-sialic acid transporter 3-like isoform X2 [Citrus sinensis] gi|557545368|gb|ESR56346.1| hypothetical protein CICLE_v10020426mg [Citrus clementina] gi|557545369|gb|ESR56347.1| hypothetical protein CICLE_v10020426mg [Citrus clementina] gi|641821692|gb|KDO41332.1| hypothetical protein CISIN_1g015473mg [Citrus sinensis] gi|641821693|gb|KDO41333.1| hypothetical protein CISIN_1g015473mg [Citrus sinensis] gi|641821694|gb|KDO41334.1| hypothetical protein CISIN_1g015473mg [Citrus sinensis] gi|641821695|gb|KDO41335.1| hypothetical protein CISIN_1g015473mg [Citrus sinensis] Length = 404 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/40 (70%), Positives = 36/40 (90%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP G+T++ +P+AM AYIYT IF+TVPSMASV Sbjct: 186 ISVNQLRSLPEGSTAMGLPVAMGAYIYTLIFITVPSMASV 225 >ref|XP_003592835.2| UDP-galactose transporter [Medicago truncatula] gi|657406138|gb|AES63086.2| UDP-galactose transporter [Medicago truncatula] Length = 408 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP G T+L +P+ M AY+YT IFVTVPSMASV Sbjct: 191 ISVNQLRSLPEGTTALGLPVTMGAYVYTFIFVTVPSMASV 230 >ref|XP_010057441.1| PREDICTED: CMP-sialic acid transporter 2 [Eucalyptus grandis] gi|702237470|ref|XP_010057525.1| PREDICTED: CMP-sialic acid transporter 2 [Eucalyptus grandis] gi|702237476|ref|XP_010057585.1| PREDICTED: CMP-sialic acid transporter 2 [Eucalyptus grandis] gi|702237480|ref|XP_010057658.1| PREDICTED: CMP-sialic acid transporter 2 [Eucalyptus grandis] gi|702237485|ref|XP_010057710.1| PREDICTED: CMP-sialic acid transporter 2 [Eucalyptus grandis] gi|629123431|gb|KCW87856.1| hypothetical protein EUGRSUZ_A00254 [Eucalyptus grandis] Length = 404 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP G T+L +P+A AY+YT IFVTVPSMASV Sbjct: 186 ISVNQLRSLPEGTTALGLPVAAGAYLYTSIFVTVPSMASV 225 >ref|XP_008802376.1| PREDICTED: CMP-sialic acid transporter 2-like isoform X3 [Phoenix dactylifera] Length = 417 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP G T+L +P+AM AYIYT IFVTVPS+ASV Sbjct: 187 ISVNQLRSLPQGTTALDLPVAMVAYIYTLIFVTVPSLASV 226 >ref|XP_008802375.1| PREDICTED: CMP-sialic acid transporter 2-like isoform X2 [Phoenix dactylifera] Length = 445 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP G T+L +P+AM AYIYT IFVTVPS+ASV Sbjct: 227 ISVNQLRSLPQGTTALDLPVAMVAYIYTLIFVTVPSLASV 266 >ref|XP_008802374.1| PREDICTED: CMP-sialic acid transporter 2-like isoform X1 [Phoenix dactylifera] Length = 457 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/40 (72%), Positives = 35/40 (87%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP G T+L +P+AM AYIYT IFVTVPS+ASV Sbjct: 227 ISVNQLRSLPQGTTALDLPVAMVAYIYTLIFVTVPSLASV 266 >ref|XP_010524134.1| PREDICTED: CMP-sialic acid transporter 2 [Tarenaya hassleriana] Length = 404 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/40 (72%), Positives = 34/40 (85%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP G+T+L IP+ AYIYT IFVTVPSMASV Sbjct: 186 ISVNQLRSLPGGSTALGIPVTTGAYIYTLIFVTVPSMASV 225 >ref|XP_013604715.1| PREDICTED: CMP-sialic acid transporter 3 [Brassica oleracea var. oleracea] gi|923715700|ref|XP_013663747.1| PREDICTED: CMP-sialic acid transporter 3 [Brassica napus] Length = 394 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP GAT++ IPLA AYI T IFVTVPSMASV Sbjct: 175 ISVNQLRSLPEGATAIGIPLATGAYICTVIFVTVPSMASV 214 >ref|XP_010912808.1| PREDICTED: CMP-sialic acid transporter 2-like [Elaeis guineensis] Length = 404 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/40 (70%), Positives = 35/40 (87%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP GAT+L +P+A AYIYT +FVTVPS+ASV Sbjct: 186 ISVNQLRSLPEGATTLGLPVATVAYIYTVVFVTVPSLASV 225 >ref|XP_010912130.1| PREDICTED: CMP-sialic acid transporter 2-like isoform X4 [Elaeis guineensis] Length = 343 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+S P G T+L +P+AM AYIYT IFVTVPS+ASV Sbjct: 125 ISVNQLRSSPQGTTALDLPVAMVAYIYTSIFVTVPSLASV 164 >ref|XP_010912129.1| PREDICTED: CMP-sialic acid transporter 2-like isoform X3 [Elaeis guineensis] Length = 352 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+S P G T+L +P+AM AYIYT IFVTVPS+ASV Sbjct: 134 ISVNQLRSSPQGTTALDLPVAMVAYIYTSIFVTVPSLASV 173 >ref|XP_010912128.1| PREDICTED: CMP-sialic acid transporter 2-like isoform X2 [Elaeis guineensis] Length = 379 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+S P G T+L +P+AM AYIYT IFVTVPS+ASV Sbjct: 161 ISVNQLRSSPQGTTALDLPVAMVAYIYTSIFVTVPSLASV 200 >ref|XP_010912126.1| PREDICTED: CMP-sialic acid transporter 2-like isoform X1 [Elaeis guineensis] gi|743763854|ref|XP_010912127.1| PREDICTED: CMP-sialic acid transporter 2-like isoform X1 [Elaeis guineensis] Length = 405 Score = 58.5 bits (140), Expect = 2e-06 Identities = 28/40 (70%), Positives = 34/40 (85%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+S P G T+L +P+AM AYIYT IFVTVPS+ASV Sbjct: 187 ISVNQLRSSPQGTTALDLPVAMVAYIYTSIFVTVPSLASV 226 >ref|XP_009383431.1| PREDICTED: CMP-sialic acid transporter 3-like [Musa acuminata subsp. malaccensis] gi|695072606|ref|XP_009383432.1| PREDICTED: CMP-sialic acid transporter 3-like [Musa acuminata subsp. malaccensis] Length = 404 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/40 (65%), Positives = 35/40 (87%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 IS+N+L+SLP G+T+L +P+ M AY+YT +FVTVPSMASV Sbjct: 186 ISINQLRSLPEGSTALGLPITMIAYVYTLVFVTVPSMASV 225 >ref|XP_009413434.1| PREDICTED: CMP-sialic acid transporter 3-like [Musa acuminata subsp. malaccensis] gi|695050860|ref|XP_009413435.1| PREDICTED: CMP-sialic acid transporter 3-like [Musa acuminata subsp. malaccensis] Length = 405 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP G+T+L +P+ M AY+YT +FVTVPSMASV Sbjct: 187 ISVNQLRSLPEGSTALGLPVTMIAYVYTLVFVTVPSMASV 226 >ref|XP_009390099.1| PREDICTED: CMP-sialic acid transporter 3-like isoform X2 [Musa acuminata subsp. malaccensis] Length = 405 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP G+T+L +P+ M AY+YT +FVTVPSMASV Sbjct: 187 ISVNQLRSLPEGSTALGLPVTMIAYVYTLVFVTVPSMASV 226 >ref|XP_009390098.1| PREDICTED: CMP-sialic acid transporter 3-like isoform X1 [Musa acuminata subsp. malaccensis] Length = 402 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/40 (67%), Positives = 35/40 (87%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP G+T+L +P+ M AY+YT +FVTVPSMASV Sbjct: 187 ISVNQLRSLPEGSTALGLPVTMIAYVYTLVFVTVPSMASV 226 >ref|XP_009116598.1| PREDICTED: CMP-sialic acid transporter 3 [Brassica rapa] Length = 394 Score = 58.5 bits (140), Expect = 2e-06 Identities = 30/40 (75%), Positives = 34/40 (85%) Frame = -1 Query: 122 ISVNRLQSLPAGATSLSIPLAMSAYIYTGIFVTVPSMASV 3 ISVN+L+SLP GAT++ IPLA AYI T IFVTVPSMASV Sbjct: 175 ISVNQLRSLPEGATAIGIPLATGAYICTVIFVTVPSMASV 214