BLASTX nr result
ID: Papaver29_contig00039861
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00039861 (676 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009418881.1| PREDICTED: type I inositol 1,4,5-trisphospha... 76 2e-11 ref|XP_006847672.1| PREDICTED: type I inositol 1,4,5-trisphospha... 75 4e-11 ref|XP_009392785.1| PREDICTED: type I inositol 1,4,5-trisphospha... 74 6e-11 ref|XP_004511772.1| PREDICTED: type I inositol 1,4,5-trisphospha... 74 1e-10 ref|XP_014509747.1| PREDICTED: type I inositol polyphosphate 5-p... 73 1e-10 ref|XP_014509746.1| PREDICTED: type I inositol polyphosphate 5-p... 73 1e-10 gb|KRH04305.1| hypothetical protein GLYMA_17G153000 [Glycine max] 73 1e-10 gb|KOM32484.1| hypothetical protein LR48_Vigan01g204000 [Vigna a... 73 1e-10 gb|KHN01671.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase... 73 1e-10 gb|KHN21026.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase... 73 1e-10 ref|XP_006579678.1| PREDICTED: type I inositol 1,4,5-trisphospha... 73 1e-10 ref|XP_006579677.1| PREDICTED: type I inositol 1,4,5-trisphospha... 73 1e-10 ref|XP_007155752.1| hypothetical protein PHAVU_003G228700g [Phas... 73 1e-10 ref|XP_007155751.1| hypothetical protein PHAVU_003G228700g [Phas... 73 1e-10 ref|XP_003549972.1| PREDICTED: type I inositol 1,4,5-trisphospha... 73 1e-10 ref|XP_012475732.1| PREDICTED: type I inositol 1,4,5-trisphospha... 72 2e-10 gb|KJB51693.1| hypothetical protein B456_008G228600 [Gossypium r... 72 2e-10 ref|XP_012439367.1| PREDICTED: type I inositol 1,4,5-trisphospha... 72 2e-10 gb|KJB51689.1| hypothetical protein B456_008G228600 [Gossypium r... 72 2e-10 ref|XP_012439365.1| PREDICTED: type I inositol 1,4,5-trisphospha... 72 2e-10 >ref|XP_009418881.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like [Musa acuminata subsp. malaccensis] Length = 597 Score = 75.9 bits (185), Expect = 2e-11 Identities = 32/38 (84%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 MR+R+G +SESFWPS+VM+KWLNIKPKVHEFSEDEVDT Sbjct: 1 MRTRKGRRSESFWPSIVMRKWLNIKPKVHEFSEDEVDT 38 >ref|XP_006847672.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2 [Amborella trichopoda] gi|548850941|gb|ERN09253.1| hypothetical protein AMTR_s00149p00041190 [Amborella trichopoda] Length = 651 Score = 75.1 bits (183), Expect = 4e-11 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 MR+RRG SE FWPS+VMKKWLNIKPKVHEFSEDE+DT Sbjct: 1 MRARRGKSSERFWPSIVMKKWLNIKPKVHEFSEDEIDT 38 >ref|XP_009392785.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like [Musa acuminata subsp. malaccensis] Length = 546 Score = 74.3 bits (181), Expect = 6e-11 Identities = 31/38 (81%), Positives = 36/38 (94%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 MR+R+G +SESFWPS+VM+KWLNIKPKVHEFSEDE DT Sbjct: 1 MRTRKGRRSESFWPSIVMRKWLNIKPKVHEFSEDEADT 38 >ref|XP_004511772.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like [Cicer arietinum] Length = 629 Score = 73.6 bits (179), Expect = 1e-10 Identities = 32/38 (84%), Positives = 36/38 (94%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M+ RRG KSE+FWPSLVMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKGRRGKKSEAFWPSLVMKKWLNIKPKVNDFSEDEVDT 38 >ref|XP_014509747.1| PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like isoform X2 [Vigna radiata var. radiata] Length = 536 Score = 73.2 bits (178), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPSLVMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDT 38 >ref|XP_014509746.1| PREDICTED: type I inositol polyphosphate 5-phosphatase 2-like isoform X1 [Vigna radiata var. radiata] Length = 622 Score = 73.2 bits (178), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPSLVMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDT 38 >gb|KRH04305.1| hypothetical protein GLYMA_17G153000 [Glycine max] Length = 473 Score = 73.2 bits (178), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPSLVMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGKRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDT 38 >gb|KOM32484.1| hypothetical protein LR48_Vigan01g204000 [Vigna angularis] Length = 579 Score = 73.2 bits (178), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPSLVMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDT 38 >gb|KHN01671.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase 2 [Glycine soja] Length = 639 Score = 73.2 bits (178), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPSLVMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGKRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDT 38 >gb|KHN21026.1| Type I inositol-1,4,5-trisphosphate 5-phosphatase 2 [Glycine soja] Length = 596 Score = 73.2 bits (178), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPSLVMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGKRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDT 38 >ref|XP_006579678.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X2 [Glycine max] gi|947109261|gb|KRH57587.1| hypothetical protein GLYMA_05G070400 [Glycine max] Length = 468 Score = 73.2 bits (178), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPSLVMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGKRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDT 38 >ref|XP_006579677.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X1 [Glycine max] gi|947109260|gb|KRH57586.1| hypothetical protein GLYMA_05G070400 [Glycine max] Length = 624 Score = 73.2 bits (178), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPSLVMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGKRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDT 38 >ref|XP_007155752.1| hypothetical protein PHAVU_003G228700g [Phaseolus vulgaris] gi|561029106|gb|ESW27746.1| hypothetical protein PHAVU_003G228700g [Phaseolus vulgaris] Length = 622 Score = 73.2 bits (178), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPSLVMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDT 38 >ref|XP_007155751.1| hypothetical protein PHAVU_003G228700g [Phaseolus vulgaris] gi|561029105|gb|ESW27745.1| hypothetical protein PHAVU_003G228700g [Phaseolus vulgaris] Length = 466 Score = 73.2 bits (178), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPSLVMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGRRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDT 38 >ref|XP_003549972.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like [Glycine max] gi|947054851|gb|KRH04304.1| hypothetical protein GLYMA_17G153000 [Glycine max] Length = 629 Score = 73.2 bits (178), Expect = 1e-10 Identities = 31/38 (81%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPSLVMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGKRSEAFWPSLVMKKWLNIKPKVYDFSEDEVDT 38 >ref|XP_012475732.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X1 [Gossypium raimondii] gi|823151806|ref|XP_012475733.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X1 [Gossypium raimondii] gi|823151808|ref|XP_012475734.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X1 [Gossypium raimondii] Length = 633 Score = 72.4 bits (176), Expect = 2e-10 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPS+VMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGKRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDT 38 >gb|KJB51693.1| hypothetical protein B456_008G228600 [Gossypium raimondii] Length = 516 Score = 72.4 bits (176), Expect = 2e-10 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPS+VMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGRRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDT 38 >ref|XP_012439367.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X2 [Gossypium raimondii] gi|763784621|gb|KJB51692.1| hypothetical protein B456_008G228600 [Gossypium raimondii] Length = 511 Score = 72.4 bits (176), Expect = 2e-10 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPS+VMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGRRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDT 38 >gb|KJB51689.1| hypothetical protein B456_008G228600 [Gossypium raimondii] Length = 474 Score = 72.4 bits (176), Expect = 2e-10 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPS+VMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGRRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDT 38 >ref|XP_012439365.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 2-like isoform X1 [Gossypium raimondii] gi|763784617|gb|KJB51688.1| hypothetical protein B456_008G228600 [Gossypium raimondii] gi|763784619|gb|KJB51690.1| hypothetical protein B456_008G228600 [Gossypium raimondii] Length = 630 Score = 72.4 bits (176), Expect = 2e-10 Identities = 30/38 (78%), Positives = 37/38 (97%) Frame = -1 Query: 115 MRSRRGNKSESFWPSLVMKKWLNIKPKVHEFSEDEVDT 2 M++RRG +SE+FWPS+VMKKWLNIKPKV++FSEDEVDT Sbjct: 1 MKTRRGRRSEAFWPSIVMKKWLNIKPKVYDFSEDEVDT 38