BLASTX nr result
ID: Papaver29_contig00039755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00039755 (704 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010547320.1| PREDICTED: katanin p80 WD40 repeat-containin... 74 1e-10 ref|XP_010547314.1| PREDICTED: katanin p80 WD40 repeat-containin... 74 1e-10 ref|XP_010547304.1| PREDICTED: katanin p80 WD40 repeat-containin... 74 1e-10 ref|XP_010547296.1| PREDICTED: katanin p80 WD40 repeat-containin... 74 1e-10 ref|XP_010547289.1| PREDICTED: katanin p80 WD40 repeat-containin... 74 1e-10 ref|XP_008442151.1| PREDICTED: katanin p80 WD40 repeat-containin... 73 2e-10 ref|XP_008442143.1| PREDICTED: katanin p80 WD40 repeat-containin... 73 2e-10 ref|XP_011653049.1| PREDICTED: katanin p80 WD40 repeat-containin... 71 8e-10 ref|XP_011653046.1| PREDICTED: katanin p80 WD40 repeat-containin... 71 8e-10 ref|XP_014518574.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 4e-09 ref|XP_014518573.1| PREDICTED: katanin p80 WD40 repeat-containin... 69 4e-09 gb|KOM53829.1| hypothetical protein LR48_Vigan09g248800 [Vigna a... 69 4e-09 ref|XP_010533879.1| PREDICTED: katanin p80 WD40 repeat-containin... 67 1e-08 ref|XP_010533878.1| PREDICTED: katanin p80 WD40 repeat-containin... 67 1e-08 ref|XP_010533877.1| PREDICTED: katanin p80 WD40 repeat-containin... 67 1e-08 ref|XP_010533875.1| PREDICTED: katanin p80 WD40 repeat-containin... 67 1e-08 ref|XP_010533874.1| PREDICTED: katanin p80 WD40 repeat-containin... 67 1e-08 ref|XP_007148216.1| hypothetical protein PHAVU_006G189900g [Phas... 66 2e-08 ref|XP_013462493.1| katanin p80 WD40 repeat subunit B1-like prot... 65 3e-08 ref|XP_003593480.2| katanin p80 WD40 repeat subunit B1-like prot... 65 3e-08 >ref|XP_010547320.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X5 [Tarenaya hassleriana] Length = 861 Score = 73.6 bits (179), Expect = 1e-10 Identities = 38/89 (42%), Positives = 58/89 (65%), Gaps = 3/89 (3%) Frame = -3 Query: 258 SHIESEREASRRMKEQEASRLIEKKREASKER---ETSRSIEKEREASRRNNEDVIDGIM 88 SHI S++ AS + E L++ + + +R + S E+ + + R+N+ D+I+ +M Sbjct: 641 SHIASKKRASAT-QTLEVPTLLDPVADVTSDRPANDISNQKEEPQGSGRQNDSDIIEDLM 699 Query: 87 QNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 Q HD FL+ L+SRLTKLQ+VRHFW RNDV Sbjct: 700 QTHDTFLTTLQSRLTKLQIVRHFWERNDV 728 >ref|XP_010547314.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X4 [Tarenaya hassleriana] Length = 977 Score = 73.6 bits (179), Expect = 1e-10 Identities = 38/89 (42%), Positives = 58/89 (65%), Gaps = 3/89 (3%) Frame = -3 Query: 258 SHIESEREASRRMKEQEASRLIEKKREASKER---ETSRSIEKEREASRRNNEDVIDGIM 88 SHI S++ AS + E L++ + + +R + S E+ + + R+N+ D+I+ +M Sbjct: 757 SHIASKKRASAT-QTLEVPTLLDPVADVTSDRPANDISNQKEEPQGSGRQNDSDIIEDLM 815 Query: 87 QNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 Q HD FL+ L+SRLTKLQ+VRHFW RNDV Sbjct: 816 QTHDTFLTTLQSRLTKLQIVRHFWERNDV 844 >ref|XP_010547304.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X3 [Tarenaya hassleriana] Length = 978 Score = 73.6 bits (179), Expect = 1e-10 Identities = 38/89 (42%), Positives = 58/89 (65%), Gaps = 3/89 (3%) Frame = -3 Query: 258 SHIESEREASRRMKEQEASRLIEKKREASKER---ETSRSIEKEREASRRNNEDVIDGIM 88 SHI S++ AS + E L++ + + +R + S E+ + + R+N+ D+I+ +M Sbjct: 758 SHIASKKRASAT-QTLEVPTLLDPVADVTSDRPANDISNQKEEPQGSGRQNDSDIIEDLM 816 Query: 87 QNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 Q HD FL+ L+SRLTKLQ+VRHFW RNDV Sbjct: 817 QTHDTFLTTLQSRLTKLQIVRHFWERNDV 845 >ref|XP_010547296.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Tarenaya hassleriana] Length = 979 Score = 73.6 bits (179), Expect = 1e-10 Identities = 38/89 (42%), Positives = 58/89 (65%), Gaps = 3/89 (3%) Frame = -3 Query: 258 SHIESEREASRRMKEQEASRLIEKKREASKER---ETSRSIEKEREASRRNNEDVIDGIM 88 SHI S++ AS + E L++ + + +R + S E+ + + R+N+ D+I+ +M Sbjct: 759 SHIASKKRASAT-QTLEVPTLLDPVADVTSDRPANDISNQKEEPQGSGRQNDSDIIEDLM 817 Query: 87 QNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 Q HD FL+ L+SRLTKLQ+VRHFW RNDV Sbjct: 818 QTHDTFLTTLQSRLTKLQIVRHFWERNDV 846 >ref|XP_010547289.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Tarenaya hassleriana] Length = 980 Score = 73.6 bits (179), Expect = 1e-10 Identities = 38/89 (42%), Positives = 58/89 (65%), Gaps = 3/89 (3%) Frame = -3 Query: 258 SHIESEREASRRMKEQEASRLIEKKREASKER---ETSRSIEKEREASRRNNEDVIDGIM 88 SHI S++ AS + E L++ + + +R + S E+ + + R+N+ D+I+ +M Sbjct: 760 SHIASKKRASAT-QTLEVPTLLDPVADVTSDRPANDISNQKEEPQGSGRQNDSDIIEDLM 818 Query: 87 QNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 Q HD FL+ L+SRLTKLQ+VRHFW RNDV Sbjct: 819 QTHDTFLTTLQSRLTKLQIVRHFWERNDV 847 >ref|XP_008442151.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Cucumis melo] Length = 920 Score = 73.2 bits (178), Expect = 2e-10 Identities = 38/85 (44%), Positives = 56/85 (65%), Gaps = 3/85 (3%) Frame = -3 Query: 246 SEREASRRMKEQEASRLIEKKREASKERETSRSIEKE---REASRRNNEDVIDGIMQNHD 76 S EA R + S LI + + + ++S+ E + R+++ N+ DVI+ +MQ+HD Sbjct: 703 SNYEAKTRNNYEAKSTLISSRVPETDKTDSSQKGEPQISGRDSTSANDRDVIEDLMQSHD 762 Query: 75 VFLSDLRSRLTKLQVVRHFWLRNDV 1 +FLS LRSR+TKLQVVRHFW RND+ Sbjct: 763 IFLSTLRSRVTKLQVVRHFWERNDM 787 >ref|XP_008442143.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Cucumis melo] Length = 922 Score = 73.2 bits (178), Expect = 2e-10 Identities = 38/85 (44%), Positives = 56/85 (65%), Gaps = 3/85 (3%) Frame = -3 Query: 246 SEREASRRMKEQEASRLIEKKREASKERETSRSIEKE---REASRRNNEDVIDGIMQNHD 76 S EA R + S LI + + + ++S+ E + R+++ N+ DVI+ +MQ+HD Sbjct: 705 SNYEAKTRNNYEAKSTLISSRVPETDKTDSSQKGEPQISGRDSTSANDRDVIEDLMQSHD 764 Query: 75 VFLSDLRSRLTKLQVVRHFWLRNDV 1 +FLS LRSR+TKLQVVRHFW RND+ Sbjct: 765 IFLSTLRSRVTKLQVVRHFWERNDM 789 >ref|XP_011653049.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Cucumis sativus] Length = 976 Score = 70.9 bits (172), Expect = 8e-10 Identities = 39/85 (45%), Positives = 53/85 (62%), Gaps = 3/85 (3%) Frame = -3 Query: 246 SEREASRRMKEQEASRLIEKKREASKERETSRSIEKE---REASRRNNEDVIDGIMQNHD 76 S EA R + S LI + + + + E + R+++ N+ DVI+ +MQ+HD Sbjct: 759 SNYEAKTRNNYEAKSTLISSHVPETDKTDNLQKGEPQISGRDSTSANDRDVIEDLMQSHD 818 Query: 75 VFLSDLRSRLTKLQVVRHFWLRNDV 1 VFLS LRSRLTKLQVVRHFW RND+ Sbjct: 819 VFLSTLRSRLTKLQVVRHFWERNDM 843 >ref|XP_011653046.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Cucumis sativus] gi|700209542|gb|KGN64638.1| hypothetical protein Csa_1G072490 [Cucumis sativus] Length = 978 Score = 70.9 bits (172), Expect = 8e-10 Identities = 39/85 (45%), Positives = 53/85 (62%), Gaps = 3/85 (3%) Frame = -3 Query: 246 SEREASRRMKEQEASRLIEKKREASKERETSRSIEKE---REASRRNNEDVIDGIMQNHD 76 S EA R + S LI + + + + E + R+++ N+ DVI+ +MQ+HD Sbjct: 761 SNYEAKTRNNYEAKSTLISSHVPETDKTDNLQKGEPQISGRDSTSANDRDVIEDLMQSHD 820 Query: 75 VFLSDLRSRLTKLQVVRHFWLRNDV 1 VFLS LRSRLTKLQVVRHFW RND+ Sbjct: 821 VFLSTLRSRLTKLQVVRHFWERNDM 845 >ref|XP_014518574.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Vigna radiata var. radiata] Length = 707 Score = 68.6 bits (166), Expect = 4e-09 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -3 Query: 135 REASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 R ++ N E++I+G+MQ HDV LS+LRSRLTKLQVVRHFW RND+ Sbjct: 530 RHSNSANEEEIIEGLMQTHDVTLSNLRSRLTKLQVVRHFWERNDI 574 >ref|XP_014518573.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Vigna radiata var. radiata] Length = 826 Score = 68.6 bits (166), Expect = 4e-09 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -3 Query: 135 REASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 R ++ N E++I+G+MQ HDV LS+LRSRLTKLQVVRHFW RND+ Sbjct: 649 RHSNSANEEEIIEGLMQTHDVTLSNLRSRLTKLQVVRHFWERNDI 693 >gb|KOM53829.1| hypothetical protein LR48_Vigan09g248800 [Vigna angularis] Length = 833 Score = 68.6 bits (166), Expect = 4e-09 Identities = 30/45 (66%), Positives = 38/45 (84%) Frame = -3 Query: 135 REASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 R ++ N E++I+G+MQ HDV LS+LRSRLTKLQVVRHFW RND+ Sbjct: 656 RHSNSANEEEIIEGLMQTHDVTLSNLRSRLTKLQVVRHFWERNDI 700 >ref|XP_010533879.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X5 [Tarenaya hassleriana] Length = 853 Score = 67.0 bits (162), Expect = 1e-08 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 2/93 (2%) Frame = -3 Query: 273 ERESLSHIESEREASRRMKEQEASRLIEKKREASKERETSRSIEKERE--ASRRNNEDVI 100 + +SHI S + AS + + ++ ++ S EKE + R N+ D++ Sbjct: 628 QTSDMSHIASRQRASPTVLDPVVNKTADELHVTPNRPANDISAEKEEPQISGRENDSDIL 687 Query: 99 DGIMQNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 + + Q HD FL+ L+SRLTKLQ+VRHFW R D+ Sbjct: 688 EDLNQTHDAFLTTLQSRLTKLQIVRHFWERKDI 720 >ref|XP_010533878.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X4 [Tarenaya hassleriana] Length = 969 Score = 67.0 bits (162), Expect = 1e-08 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 2/93 (2%) Frame = -3 Query: 273 ERESLSHIESEREASRRMKEQEASRLIEKKREASKERETSRSIEKERE--ASRRNNEDVI 100 + +SHI S + AS + + ++ ++ S EKE + R N+ D++ Sbjct: 744 QTSDMSHIASRQRASPTVLDPVVNKTADELHVTPNRPANDISAEKEEPQISGRENDSDIL 803 Query: 99 DGIMQNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 + + Q HD FL+ L+SRLTKLQ+VRHFW R D+ Sbjct: 804 EDLNQTHDAFLTTLQSRLTKLQIVRHFWERKDI 836 >ref|XP_010533877.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X3 [Tarenaya hassleriana] Length = 970 Score = 67.0 bits (162), Expect = 1e-08 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 2/93 (2%) Frame = -3 Query: 273 ERESLSHIESEREASRRMKEQEASRLIEKKREASKERETSRSIEKERE--ASRRNNEDVI 100 + +SHI S + AS + + ++ ++ S EKE + R N+ D++ Sbjct: 745 QTSDMSHIASRQRASPTVLDPVVNKTADELHVTPNRPANDISAEKEEPQISGRENDSDIL 804 Query: 99 DGIMQNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 + + Q HD FL+ L+SRLTKLQ+VRHFW R D+ Sbjct: 805 EDLNQTHDAFLTTLQSRLTKLQIVRHFWERKDI 837 >ref|XP_010533875.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X2 [Tarenaya hassleriana] Length = 971 Score = 67.0 bits (162), Expect = 1e-08 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 2/93 (2%) Frame = -3 Query: 273 ERESLSHIESEREASRRMKEQEASRLIEKKREASKERETSRSIEKERE--ASRRNNEDVI 100 + +SHI S + AS + + ++ ++ S EKE + R N+ D++ Sbjct: 746 QTSDMSHIASRQRASPTVLDPVVNKTADELHVTPNRPANDISAEKEEPQISGRENDSDIL 805 Query: 99 DGIMQNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 + + Q HD FL+ L+SRLTKLQ+VRHFW R D+ Sbjct: 806 EDLNQTHDAFLTTLQSRLTKLQIVRHFWERKDI 838 >ref|XP_010533874.1| PREDICTED: katanin p80 WD40 repeat-containing subunit B1 homolog isoform X1 [Tarenaya hassleriana] Length = 972 Score = 67.0 bits (162), Expect = 1e-08 Identities = 33/93 (35%), Positives = 52/93 (55%), Gaps = 2/93 (2%) Frame = -3 Query: 273 ERESLSHIESEREASRRMKEQEASRLIEKKREASKERETSRSIEKERE--ASRRNNEDVI 100 + +SHI S + AS + + ++ ++ S EKE + R N+ D++ Sbjct: 747 QTSDMSHIASRQRASPTVLDPVVNKTADELHVTPNRPANDISAEKEEPQISGRENDSDIL 806 Query: 99 DGIMQNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 + + Q HD FL+ L+SRLTKLQ+VRHFW R D+ Sbjct: 807 EDLNQTHDAFLTTLQSRLTKLQIVRHFWERKDI 839 >ref|XP_007148216.1| hypothetical protein PHAVU_006G189900g [Phaseolus vulgaris] gi|561021439|gb|ESW20210.1| hypothetical protein PHAVU_006G189900g [Phaseolus vulgaris] Length = 828 Score = 66.2 bits (160), Expect = 2e-08 Identities = 29/44 (65%), Positives = 37/44 (84%) Frame = -3 Query: 132 EASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 +++ N E +I+G+MQ HDV LS+LRSRLTKLQVVRHFW RND+ Sbjct: 652 DSNSANEEKIIEGLMQTHDVTLSNLRSRLTKLQVVRHFWERNDI 695 >ref|XP_013462493.1| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula] gi|657396574|gb|KEH36528.1| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula] Length = 1030 Score = 65.5 bits (158), Expect = 3e-08 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = -3 Query: 138 EREASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 +R++S N +I+G+M+ HDV LS+LRSRLTKLQVVRHFW RND+ Sbjct: 933 QRDSSSPNEMAIIEGLMETHDVTLSNLRSRLTKLQVVRHFWERNDI 978 >ref|XP_003593480.2| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula] gi|657396573|gb|AES63731.2| katanin p80 WD40 repeat subunit B1-like protein [Medicago truncatula] Length = 1111 Score = 65.5 bits (158), Expect = 3e-08 Identities = 29/46 (63%), Positives = 38/46 (82%) Frame = -3 Query: 138 EREASRRNNEDVIDGIMQNHDVFLSDLRSRLTKLQVVRHFWLRNDV 1 +R++S N +I+G+M+ HDV LS+LRSRLTKLQVVRHFW RND+ Sbjct: 933 QRDSSSPNEMAIIEGLMETHDVTLSNLRSRLTKLQVVRHFWERNDI 978