BLASTX nr result
ID: Papaver29_contig00039607
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00039607 (425 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009377254.1| PREDICTED: ethylene-responsive transcription... 57 4e-06 ref|XP_008354035.1| PREDICTED: ethylene-responsive transcription... 57 4e-06 ref|XP_008348605.1| PREDICTED: ethylene-responsive transcription... 57 4e-06 gb|ADE41113.1| AP2 domain class transcription factor [Malus dome... 57 4e-06 ref|XP_007051000.1| Integrase-type DNA-binding superfamily prote... 56 9e-06 >ref|XP_009377254.1| PREDICTED: ethylene-responsive transcription factor CRF4 [Pyrus x bretschneideri] Length = 282 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = +3 Query: 273 GKKYRGVRCKKTKSGNKWLAEIVDISRGIQLHLGKFNTAKEAAMAYDKEAI 425 GKKYRGVR + KW AEI D RG+++ LG F TA+EA MAYDK AI Sbjct: 106 GKKYRGVR---QRPWGKWAAEIRDPKRGVRVWLGTFETAEEAGMAYDKAAI 153 >ref|XP_008354035.1| PREDICTED: ethylene-responsive transcription factor CRF6-like, partial [Malus domestica] Length = 179 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = +3 Query: 273 GKKYRGVRCKKTKSGNKWLAEIVDISRGIQLHLGKFNTAKEAAMAYDKEAI 425 GKKYRGVR + KW AEI D RG+++ LG F TA+EA MAYDK AI Sbjct: 3 GKKYRGVR---QRPWGKWAAEIRDPKRGVRVWLGTFETAEEAGMAYDKAAI 50 >ref|XP_008348605.1| PREDICTED: ethylene-responsive transcription factor CRF4-like [Malus domestica] Length = 282 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = +3 Query: 273 GKKYRGVRCKKTKSGNKWLAEIVDISRGIQLHLGKFNTAKEAAMAYDKEAI 425 GKKYRGVR + KW AEI D RG+++ LG F TA+EA MAYDK AI Sbjct: 106 GKKYRGVR---QRPWGKWAAEIRDPKRGVRVWLGTFETAEEAGMAYDKAAI 153 >gb|ADE41113.1| AP2 domain class transcription factor [Malus domestica] Length = 282 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = +3 Query: 273 GKKYRGVRCKKTKSGNKWLAEIVDISRGIQLHLGKFNTAKEAAMAYDKEAI 425 GKKYRGVR + KW AEI D RG+++ LG F TA+EA MAYDK AI Sbjct: 106 GKKYRGVR---QRPWGKWAAEIRDPKRGVRVWLGTFETAEEAGMAYDKAAI 153 >ref|XP_007051000.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma cacao] gi|508703261|gb|EOX95157.1| Integrase-type DNA-binding superfamily protein, putative [Theobroma cacao] Length = 295 Score = 56.2 bits (134), Expect = 9e-06 Identities = 29/71 (40%), Positives = 46/71 (64%), Gaps = 4/71 (5%) Frame = +3 Query: 222 GEEEQITIGICRRSNKPGKK----YRGVRCKKTKSGNKWLAEIVDISRGIQLHLGKFNTA 389 G + + ++G+ + KP ++ YRG+R + KW AEI D+ +G+++ LG FNTA Sbjct: 54 GPQTEPSLGVEQVEKKPKRQRKNLYRGIR---QRPWGKWAAEIRDLGKGVRVWLGTFNTA 110 Query: 390 KEAAMAYDKEA 422 +EAA AYD+EA Sbjct: 111 EEAARAYDREA 121