BLASTX nr result
ID: Papaver29_contig00038846
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00038846 (412 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containi... 62 1e-07 >ref|XP_002275491.1| PREDICTED: pentatricopeptide repeat-containing protein At3g61520, mitochondrial [Vitis vinifera] gi|297745328|emb|CBI40408.3| unnamed protein product [Vitis vinifera] Length = 765 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/58 (44%), Positives = 41/58 (70%) Frame = -3 Query: 176 FSCFNKIETSERNTHLYNTLLAILFKSDRIDNAVVLFDEMLQPGCKFPPNGSTGSVIY 3 F +N++ S R TH+ N L+ +LF+ R+D+A+ L DEMLQP +FPPN +TG +++ Sbjct: 179 FLVYNELCPSRRLTHIRNILIDVLFRKGRVDDALHLLDEMLQPKAEFPPNSNTGHIVF 236