BLASTX nr result
ID: Papaver29_contig00038738
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00038738 (438 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010259723.1| PREDICTED: putative 1-phosphatidylinositol-3... 57 4e-06 >ref|XP_010259723.1| PREDICTED: putative 1-phosphatidylinositol-3-phosphate 5-kinase FAB1C [Nelumbo nucifera] Length = 1814 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = -2 Query: 113 MGIPDRSLLDFIEKVRSWVPWGVSDISGVSQEF 15 MGIPD SLLD I KVRSW+PWG SD+SG S+EF Sbjct: 1 MGIPDSSLLDLIGKVRSWIPWGRSDLSGFSREF 33