BLASTX nr result
ID: Papaver29_contig00037471
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00037471 (583 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010265318.1| PREDICTED: putative nuclear matrix constitue... 57 9e-06 ref|XP_010265312.1| PREDICTED: putative nuclear matrix constitue... 57 9e-06 >ref|XP_010265318.1| PREDICTED: putative nuclear matrix constituent protein 1-like protein isoform X2 [Nelumbo nucifera] Length = 1238 Score = 56.6 bits (135), Expect = 9e-06 Identities = 38/70 (54%), Positives = 43/70 (61%), Gaps = 11/70 (15%) Frame = -1 Query: 184 MFTPQRKV-NNWSLTPH----KNGGSSTVQNPRK------SDSKGKSSNFSEGITPPPVN 38 MFTPQRKV + WSLTP KNGG+S V NPR S +KGKS F EG PPP+ Sbjct: 1 MFTPQRKVWSGWSLTPRSDVRKNGGAS-VPNPRNGGGGDGSVAKGKSVAFLEG-PPPPLG 58 Query: 37 FLGENGGGGV 8 L +NGG V Sbjct: 59 SLADNGGNNV 68 >ref|XP_010265312.1| PREDICTED: putative nuclear matrix constituent protein 1-like protein isoform X1 [Nelumbo nucifera] gi|720029758|ref|XP_010265313.1| PREDICTED: putative nuclear matrix constituent protein 1-like protein isoform X1 [Nelumbo nucifera] gi|720029761|ref|XP_010265315.1| PREDICTED: putative nuclear matrix constituent protein 1-like protein isoform X1 [Nelumbo nucifera] gi|720029764|ref|XP_010265316.1| PREDICTED: putative nuclear matrix constituent protein 1-like protein isoform X1 [Nelumbo nucifera] gi|720029767|ref|XP_010265317.1| PREDICTED: putative nuclear matrix constituent protein 1-like protein isoform X1 [Nelumbo nucifera] Length = 1239 Score = 56.6 bits (135), Expect = 9e-06 Identities = 38/70 (54%), Positives = 43/70 (61%), Gaps = 11/70 (15%) Frame = -1 Query: 184 MFTPQRKV-NNWSLTPH----KNGGSSTVQNPRK------SDSKGKSSNFSEGITPPPVN 38 MFTPQRKV + WSLTP KNGG+S V NPR S +KGKS F EG PPP+ Sbjct: 1 MFTPQRKVWSGWSLTPRSDVRKNGGAS-VPNPRNGGGGDGSVAKGKSVAFLEG-PPPPLG 58 Query: 37 FLGENGGGGV 8 L +NGG V Sbjct: 59 SLADNGGNNV 68