BLASTX nr result
ID: Papaver29_contig00037445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00037445 (466 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_013448621.1| F-box protein interaction domain protein [Me... 57 5e-06 ref|XP_013441861.1| F-box protein interaction domain protein [Me... 57 7e-06 >ref|XP_013448621.1| F-box protein interaction domain protein [Medicago truncatula] gi|657377804|gb|KEH22648.1| F-box protein interaction domain protein [Medicago truncatula] Length = 422 Score = 57.0 bits (136), Expect = 5e-06 Identities = 29/57 (50%), Positives = 39/57 (68%) Frame = +2 Query: 293 PKFPPLTGCTSHPIMGNELLLSEILTRVPVKPLMRFKCVCKQWYSLIHTDRSFIDLH 463 PK P +G I+ +EL+ ++IL+R+PVK LM+FKCVCK W +LI D SF LH Sbjct: 8 PKHPHSSGGAPTSILLDELI-TDILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLH 63 >ref|XP_013441861.1| F-box protein interaction domain protein [Medicago truncatula] gi|657369443|gb|KEH15886.1| F-box protein interaction domain protein [Medicago truncatula] Length = 430 Score = 56.6 bits (135), Expect = 7e-06 Identities = 31/58 (53%), Positives = 40/58 (68%), Gaps = 2/58 (3%) Frame = +2 Query: 296 KFPPLTGC--TSHPIMGNELLLSEILTRVPVKPLMRFKCVCKQWYSLIHTDRSFIDLH 463 K PP C TS ++ +EL++ EIL+R+PVK LM+FKCVCK W +LI D SF LH Sbjct: 8 KSPPSNCCATTSLIVLLDELIV-EILSRLPVKTLMQFKCVCKSWKTLISHDPSFAKLH 64