BLASTX nr result
ID: Papaver29_contig00037094
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00037094 (404 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012484548.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 92 2e-16 ref|XP_007035706.1| TRNA (guanine-N-7) methyltransferase isoform... 92 2e-16 ref|XP_006483612.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 91 3e-16 ref|XP_006450120.1| hypothetical protein CICLE_v10009277mg [Citr... 91 3e-16 ref|XP_010259912.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 91 4e-16 ref|XP_008445047.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 91 4e-16 ref|XP_011649744.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 90 6e-16 gb|KHG15263.1| hypothetical protein F383_05014 [Gossypium arboreum] 90 6e-16 ref|XP_004501204.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 90 6e-16 ref|XP_004138787.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 90 6e-16 ref|XP_012086127.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 90 7e-16 ref|XP_012086126.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 90 7e-16 ref|XP_012086123.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 90 7e-16 ref|XP_009345248.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 90 7e-16 ref|XP_008357422.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 90 7e-16 ref|XP_008378118.1| PREDICTED: LOW QUALITY PROTEIN: tRNA (guanin... 90 7e-16 ref|XP_008219993.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 89 1e-15 ref|XP_002529629.1| tRNA (guanine-n(7)-)-methyltransferase, puta... 89 1e-15 ref|XP_003603585.1| tRNA (guanine-N(7))-methyltransferase [Medic... 89 1e-15 ref|XP_010677158.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransf... 88 2e-15 >ref|XP_012484548.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Gossypium raimondii] gi|823170663|ref|XP_012484549.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Gossypium raimondii] gi|763767455|gb|KJB34670.1| hypothetical protein B456_006G077600 [Gossypium raimondii] Length = 256 Score = 92.0 bits (227), Expect = 2e-16 Identities = 40/53 (75%), Positives = 44/53 (83%) Frame = -2 Query: 163 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 K NP N +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP +PS Sbjct: 5 KANPTINKSTGLPRKRFYRARAHSNPLSDSHFPVPLSPSHVDYSLHYPQLFPS 57 >ref|XP_007035706.1| TRNA (guanine-N-7) methyltransferase isoform 1 [Theobroma cacao] gi|590661559|ref|XP_007035707.1| TRNA (guanine-N-7) methyltransferase isoform 1 [Theobroma cacao] gi|508714735|gb|EOY06632.1| TRNA (guanine-N-7) methyltransferase isoform 1 [Theobroma cacao] gi|508714736|gb|EOY06633.1| TRNA (guanine-N-7) methyltransferase isoform 1 [Theobroma cacao] Length = 251 Score = 91.7 bits (226), Expect = 2e-16 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = -2 Query: 163 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 K NP N +TGLPRKRFYRARAHSNPLSDSHFP+P +PS VDY+ HYP +PS Sbjct: 5 KANPTINKSTGLPRKRFYRARAHSNPLSDSHFPIPLSPSHVDYSLHYPQLFPS 57 >ref|XP_006483612.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X1 [Citrus sinensis] gi|568860200|ref|XP_006483613.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X2 [Citrus sinensis] gi|568860202|ref|XP_006483614.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X3 [Citrus sinensis] gi|641848336|gb|KDO67213.1| hypothetical protein CISIN_1g025492mg [Citrus sinensis] gi|641848337|gb|KDO67214.1| hypothetical protein CISIN_1g025492mg [Citrus sinensis] gi|641848338|gb|KDO67215.1| hypothetical protein CISIN_1g025492mg [Citrus sinensis] Length = 252 Score = 91.3 bits (225), Expect = 3e-16 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -2 Query: 157 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYP 8 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYPH++P Sbjct: 7 NPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPHFFP 56 >ref|XP_006450120.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|567916230|ref|XP_006450121.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|567916232|ref|XP_006450122.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|557553346|gb|ESR63360.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|557553347|gb|ESR63361.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] gi|557553348|gb|ESR63362.1| hypothetical protein CICLE_v10009277mg [Citrus clementina] Length = 252 Score = 91.3 bits (225), Expect = 3e-16 Identities = 38/50 (76%), Positives = 44/50 (88%) Frame = -2 Query: 157 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYP 8 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYPH++P Sbjct: 7 NPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPHFFP 56 >ref|XP_010259912.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Nelumbo nucifera] gi|720012599|ref|XP_010259913.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Nelumbo nucifera] gi|720012602|ref|XP_010259914.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Nelumbo nucifera] Length = 278 Score = 90.5 bits (223), Expect = 4e-16 Identities = 39/53 (73%), Positives = 43/53 (81%) Frame = -2 Query: 163 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 K N K N +TGLPRKRFYRARAHSNPLSDSHFPVP P VDY+ HYP ++PS Sbjct: 7 KANLKHNKSTGLPRKRFYRARAHSNPLSDSHFPVPITPYNVDYSEHYPEFFPS 59 >ref|XP_008445047.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Cucumis melo] gi|659088563|ref|XP_008445048.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Cucumis melo] gi|659088565|ref|XP_008445050.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Cucumis melo] gi|659088567|ref|XP_008445051.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Cucumis melo] Length = 252 Score = 90.5 bits (223), Expect = 4e-16 Identities = 39/53 (73%), Positives = 45/53 (84%) Frame = -2 Query: 163 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 + NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PSEVDY+ HYP +PS Sbjct: 5 EANPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSEVDYSLHYPQLFPS 57 >ref|XP_011649744.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase isoform X1 [Cucumis sativus] Length = 260 Score = 90.1 bits (222), Expect = 6e-16 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = -2 Query: 163 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 + NP + +TGLPRKRFYRARAHSNPLSDSHFP+P +PSEVDY+ HYP +PS Sbjct: 13 EANPTISKSTGLPRKRFYRARAHSNPLSDSHFPIPISPSEVDYSLHYPQLFPS 65 >gb|KHG15263.1| hypothetical protein F383_05014 [Gossypium arboreum] Length = 269 Score = 90.1 bits (222), Expect = 6e-16 Identities = 39/53 (73%), Positives = 44/53 (83%) Frame = -2 Query: 163 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 K NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP +PS Sbjct: 18 KANPTISKSTGLPRKRFYRARAHSNPLSDSHFPVPLSPSHVDYSLHYPQLFPS 70 >ref|XP_004501204.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Cicer arietinum] Length = 255 Score = 90.1 bits (222), Expect = 6e-16 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -2 Query: 157 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP ++PS Sbjct: 7 NPTHSKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSLHYPQFFPS 57 >ref|XP_004138787.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase isoform X2 [Cucumis sativus] gi|778672126|ref|XP_011649745.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase isoform X2 [Cucumis sativus] gi|778672130|ref|XP_011649746.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase isoform X2 [Cucumis sativus] gi|778672133|ref|XP_011649747.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase isoform X2 [Cucumis sativus] gi|700207721|gb|KGN62840.1| hypothetical protein Csa_2G376290 [Cucumis sativus] Length = 252 Score = 90.1 bits (222), Expect = 6e-16 Identities = 38/53 (71%), Positives = 45/53 (84%) Frame = -2 Query: 163 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 + NP + +TGLPRKRFYRARAHSNPLSDSHFP+P +PSEVDY+ HYP +PS Sbjct: 5 EANPTISKSTGLPRKRFYRARAHSNPLSDSHFPIPISPSEVDYSLHYPQLFPS 57 >ref|XP_012086127.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X2 [Jatropha curcas] Length = 218 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -2 Query: 157 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP ++PS Sbjct: 7 NPTLSKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSVHYPQFFPS 57 >ref|XP_012086126.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like isoform X1 [Jatropha curcas] Length = 252 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -2 Query: 157 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP ++PS Sbjct: 7 NPTLSKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSVHYPQFFPS 57 >ref|XP_012086123.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Jatropha curcas] Length = 252 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/51 (74%), Positives = 44/51 (86%) Frame = -2 Query: 157 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP ++PS Sbjct: 7 NPTLSKSTGLPRKRFYRARAHSNPLSDSHFPVPISPSHVDYSVHYPQFFPS 57 >ref|XP_009345248.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Pyrus x bretschneideri] Length = 252 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -2 Query: 157 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +P VDY+ HYP Y+PS Sbjct: 7 NPTFSKSTGLPRKRFYRARAHSNPLSDSHFPVPVSPRHVDYSVHYPQYFPS 57 >ref|XP_008357422.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase-like [Malus domestica] Length = 252 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -2 Query: 157 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +P VDY+ HYP Y+PS Sbjct: 7 NPTFSKSTGLPRKRFYRARAHSNPLSDSHFPVPVSPRHVDYSVHYPQYFPS 57 >ref|XP_008378118.1| PREDICTED: LOW QUALITY PROTEIN: tRNA (guanine-N(7)-)-methyltransferase-like [Malus domestica] Length = 252 Score = 89.7 bits (221), Expect = 7e-16 Identities = 38/51 (74%), Positives = 43/51 (84%) Frame = -2 Query: 157 NPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +P VDY+ HYP Y+PS Sbjct: 7 NPTFSKSTGLPRKRFYRARAHSNPLSDSHFPVPVSPRHVDYSVHYPQYFPS 57 >ref|XP_008219993.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Prunus mume] Length = 252 Score = 89.0 bits (219), Expect = 1e-15 Identities = 37/53 (69%), Positives = 45/53 (84%) Frame = -2 Query: 163 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 + NP + +TGLPRKRFYRARAHSNPLSDSHFPVP +P +VDY+ HYP ++PS Sbjct: 5 EANPTFSKSTGLPRKRFYRARAHSNPLSDSHFPVPISPGQVDYSLHYPQHFPS 57 >ref|XP_002529629.1| tRNA (guanine-n(7)-)-methyltransferase, putative [Ricinus communis] gi|223530914|gb|EEF32774.1| tRNA (guanine-n(7)-)-methyltransferase, putative [Ricinus communis] Length = 252 Score = 89.0 bits (219), Expect = 1e-15 Identities = 38/52 (73%), Positives = 43/52 (82%) Frame = -2 Query: 163 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYP 8 K NP N +TGLPRKRFYRARAHSNPLSDSHFPVP +P +VDY+ HYP +P Sbjct: 5 KANPTINKSTGLPRKRFYRARAHSNPLSDSHFPVPFSPCQVDYSLHYPQIFP 56 >ref|XP_003603585.1| tRNA (guanine-N(7))-methyltransferase [Medicago truncatula] gi|355492633|gb|AES73836.1| tRNA (guanine-N(7))-methyltransferase [Medicago truncatula] gi|388511605|gb|AFK43864.1| unknown [Medicago truncatula] Length = 255 Score = 89.0 bits (219), Expect = 1e-15 Identities = 38/52 (73%), Positives = 44/52 (84%) Frame = -2 Query: 160 GNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 GN + +TGLPRKRFYRARAHSNPLSDSHFPVP +PS VDY+ HYP ++PS Sbjct: 6 GNSTFSKSTGLPRKRFYRARAHSNPLSDSHFPVPLSPSHVDYSLHYPQFFPS 57 >ref|XP_010677158.1| PREDICTED: tRNA (guanine-N(7)-)-methyltransferase [Beta vulgaris subsp. vulgaris] gi|870860516|gb|KMT11852.1| hypothetical protein BVRB_5g105480 [Beta vulgaris subsp. vulgaris] Length = 252 Score = 88.2 bits (217), Expect = 2e-15 Identities = 38/53 (71%), Positives = 43/53 (81%) Frame = -2 Query: 163 KGNPKSNNTTGLPRKRFYRARAHSNPLSDSHFPVPTAPSEVDYASHYPHYYPS 5 K NP N +TGLPRKRFYRARAHSNPLSDSHFPVP +P VDY+ H+P +PS Sbjct: 5 KVNPTKNKSTGLPRKRFYRARAHSNPLSDSHFPVPLSPHHVDYSLHFPQIFPS 57