BLASTX nr result
ID: Papaver29_contig00035101
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00035101 (507 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010542529.1| PREDICTED: 30S ribosomal protein S10, chloro... 53 8e-06 ref|XP_006848986.2| PREDICTED: 30S ribosomal protein S10, chloro... 56 9e-06 gb|ERN10567.1| hypothetical protein AMTR_s00028p00072750 [Ambore... 56 9e-06 >ref|XP_010542529.1| PREDICTED: 30S ribosomal protein S10, chloroplastic-like isoform X2 [Tarenaya hassleriana] Length = 196 Score = 52.8 bits (125), Expect(2) = 8e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -1 Query: 108 RSYYVPLIEESCKLTKDAAKTSNMKTMCPVYLPTKK 1 RSY+VPLIE+SCK DAA+ +N KTM PV LPTKK Sbjct: 105 RSYWVPLIEDSCKQILDAARNTNAKTMGPVPLPTKK 140 Score = 23.5 bits (49), Expect(2) = 8e-06 Identities = 14/30 (46%), Positives = 17/30 (56%) Frame = -3 Query: 196 SEIHGTPKISIEDDCIDKMKLTPKIRIKLK 107 SE+ IS E +DKM KIRIKL+ Sbjct: 79 SEVPSASSISAE---VDKMAPKQKIRIKLR 105 >ref|XP_006848986.2| PREDICTED: 30S ribosomal protein S10, chloroplastic [Amborella trichopoda] Length = 209 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 108 RSYYVPLIEESCKLTKDAAKTSNMKTMCPVYLPTKK 1 RSY+VPLIE+SCK DAAKT+N KTM PV LPTKK Sbjct: 118 RSYWVPLIEDSCKQIMDAAKTTNAKTMGPVPLPTKK 153 >gb|ERN10567.1| hypothetical protein AMTR_s00028p00072750 [Amborella trichopoda] Length = 103 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 108 RSYYVPLIEESCKLTKDAAKTSNMKTMCPVYLPTKK 1 RSY+VPLIE+SCK DAAKT+N KTM PV LPTKK Sbjct: 12 RSYWVPLIEDSCKQIMDAAKTTNAKTMGPVPLPTKK 47