BLASTX nr result
ID: Papaver29_contig00032905
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00032905 (695 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010259128.1| PREDICTED: pentatricopeptide repeat-containi... 46 1e-06 ref|XP_010259136.1| PREDICTED: pentatricopeptide repeat-containi... 46 1e-06 >ref|XP_010259128.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like isoform X1 [Nelumbo nucifera] Length = 520 Score = 45.8 bits (107), Expect(2) = 1e-06 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -1 Query: 146 IIFDEAPLKDRGLWGSIISTYVQ 78 +IFDEAP+KDRG+WGSIIS YVQ Sbjct: 191 LIFDEAPMKDRGIWGSIISGYVQ 213 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 19/39 (48%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = -3 Query: 288 KLGSDGDISVGNTL---YSSCARIVEARLLFEKIPDRTA 181 KLG DI VGNT+ YS+C + A +F++IP RTA Sbjct: 132 KLGFLFDIFVGNTMILMYSACGMMEAAARIFDEIPHRTA 170 >ref|XP_010259136.1| PREDICTED: pentatricopeptide repeat-containing protein At2g22410, mitochondrial-like isoform X2 [Nelumbo nucifera] Length = 452 Score = 45.8 bits (107), Expect(2) = 1e-06 Identities = 19/23 (82%), Positives = 22/23 (95%) Frame = -1 Query: 146 IIFDEAPLKDRGLWGSIISTYVQ 78 +IFDEAP+KDRG+WGSIIS YVQ Sbjct: 123 LIFDEAPMKDRGIWGSIISGYVQ 145 Score = 34.3 bits (77), Expect(2) = 1e-06 Identities = 19/39 (48%), Positives = 25/39 (64%), Gaps = 3/39 (7%) Frame = -3 Query: 288 KLGSDGDISVGNTL---YSSCARIVEARLLFEKIPDRTA 181 KLG DI VGNT+ YS+C + A +F++IP RTA Sbjct: 64 KLGFLFDIFVGNTMILMYSACGMMEAAARIFDEIPHRTA 102