BLASTX nr result
ID: Papaver29_contig00031949
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00031949 (590 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006590898.1| PREDICTED: ras-related protein Rab7 isoform ... 49 1e-07 >ref|XP_006590898.1| PREDICTED: ras-related protein Rab7 isoform X2 [Glycine max] gi|947080688|gb|KRH29477.1| hypothetical protein GLYMA_11G118800 [Glycine max] Length = 179 Score = 48.9 bits (115), Expect(2) = 1e-07 Identities = 30/54 (55%), Positives = 39/54 (72%), Gaps = 2/54 (3%) Frame = -3 Query: 156 KSFESLNN*RE*FLIQVSKRKETSTVCIQRKH--SFENSS*EGLNVKEAFQVIA 1 KSF++LNN RE FLIQVS++K + C + + FE S+ EGLNV+EAFQ IA Sbjct: 94 KSFDNLNNWREEFLIQVSEKKARAW-CASKGNIPYFETSAKEGLNVEEAFQCIA 146 Score = 33.9 bits (76), Expect(2) = 1e-07 Identities = 15/22 (68%), Positives = 17/22 (77%) Frame = -2 Query: 259 IQILDATGQERFQNLAVAFYCG 194 +QI D GQERFQ+L VAFY G Sbjct: 59 LQIWDTAGQERFQSLGVAFYRG 80