BLASTX nr result
ID: Papaver29_contig00031504
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00031504 (429 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP41341.1| hypothetical protein JCGZ_15748 [Jatropha curcas] 64 6e-08 gb|KJB46757.1| hypothetical protein B456_008G175600 [Gossypium r... 59 1e-06 >gb|KDP41341.1| hypothetical protein JCGZ_15748 [Jatropha curcas] Length = 71 Score = 63.5 bits (153), Expect = 6e-08 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -2 Query: 281 SSESSGSNRKTMKAPGKDERIYRDEFEKDAAFYFRNER 168 S SSGS+RKTMKAPGKD RI+RDEFEKD A YFRN R Sbjct: 32 SKPSSGSSRKTMKAPGKDGRIFRDEFEKDPAAYFRNNR 69 >gb|KJB46757.1| hypothetical protein B456_008G175600 [Gossypium raimondii] Length = 69 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -2 Query: 272 SSGSNRKTMKAPGKDERIYRDEFEKDAAFYFRNERK 165 SS SNRKTMKAPG++ RIYRD+FE+D A YFRN RK Sbjct: 34 SSSSNRKTMKAPGRNYRIYRDDFERDPASYFRNLRK 69