BLASTX nr result
ID: Papaver29_contig00029535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00029535 (1516 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010262408.1| PREDICTED: tetratricopeptide repeat protein ... 63 8e-07 >ref|XP_010262408.1| PREDICTED: tetratricopeptide repeat protein 7A-like [Nelumbo nucifera] Length = 731 Score = 62.8 bits (151), Expect = 8e-07 Identities = 33/58 (56%), Positives = 42/58 (72%) Frame = -3 Query: 578 QRQNRHFSSGIAIPMSMNAVSLFFKAIFLKEKWLTTL*SYGEAAQ*CKMILDTVESQI 405 +R+ RH S ++ PM M+AVSL F+AIFLK K L L + EAAQ CK+ILDTVES + Sbjct: 129 ERRRRHSQSDVSPPMPMHAVSLLFEAIFLKAKSLQDLGRFQEAAQSCKIILDTVESAL 186