BLASTX nr result
ID: Papaver29_contig00028385
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00028385 (770 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHG09936.1| hypothetical protein F383_14565 [Gossypium arboreum] 62 6e-07 gb|KCW84500.1| hypothetical protein EUGRSUZ_B01334 [Eucalyptus g... 59 4e-06 >gb|KHG09936.1| hypothetical protein F383_14565 [Gossypium arboreum] Length = 39 Score = 61.6 bits (148), Expect = 6e-07 Identities = 30/37 (81%), Positives = 34/37 (91%) Frame = +2 Query: 659 INIRRGRTISVEMTDLFSVLSIGSIITSHTLIFRKYR 769 + IRR +TIS++MTD FSVLSIGSIITSHTLIFRKYR Sbjct: 1 MTIRRDKTISIKMTDPFSVLSIGSIITSHTLIFRKYR 37 >gb|KCW84500.1| hypothetical protein EUGRSUZ_B01334 [Eucalyptus grandis] Length = 68 Score = 58.9 bits (141), Expect = 4e-06 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -3 Query: 684 MVLPRRIFILISGARNP*IKKNLNYDSYLLFRPRDRTQKNF 562 MVLPRRIFI +SGARN +N+NYDSYL+FRPRD T K F Sbjct: 1 MVLPRRIFIRVSGARNR--SQNINYDSYLIFRPRDWTPKKF 39