BLASTX nr result
ID: Papaver29_contig00028297
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00028297 (973 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010538743.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 44 5e-07 ref|XP_009135756.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 44 5e-07 ref|XP_013734008.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 44 5e-07 ref|XP_013617442.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 44 5e-07 ref|XP_013672048.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 44 5e-07 ref|XP_006413676.1| hypothetical protein EUTSA_v10025624mg [Eutr... 44 5e-07 ref|XP_008803504.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 42 5e-07 ref|XP_010434065.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 44 6e-07 ref|XP_006284019.1| hypothetical protein CARUB_v10005140mg [Caps... 44 6e-07 ref|XP_010448915.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 44 6e-07 ref|XP_010439355.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 44 6e-07 ref|XP_010439354.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 44 6e-07 emb|CDP04461.1| unnamed protein product [Coffea canephora] 44 6e-07 emb|CAA06190.1| Immutans protein [Arabidopsis thaliana] 44 6e-07 ref|NP_567658.1| alternative oxidase protein IMMUTANS [Arabidops... 44 6e-07 ref|XP_002867779.1| hypothetical protein ARALYDRAFT_492640 [Arab... 44 6e-07 gb|KFK28796.1| hypothetical protein AALP_AA7G049400 [Arabis alpina] 44 6e-07 emb|CAA16776.1| putative protein [Arabidopsis thaliana] gi|72690... 44 6e-07 ref|XP_011096019.1| PREDICTED: ubiquinol oxidase 4, chloroplasti... 43 8e-07 emb|CBI41029.3| unnamed protein product [Vitis vinifera] 43 1e-06 >ref|XP_010538743.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic [Tarenaya hassleriana] Length = 365 Score = 44.3 bits (103), Expect(2) = 5e-07 Identities = 22/48 (45%), Positives = 31/48 (64%), Gaps = 1/48 (2%) Frame = -1 Query: 739 SISYPHWFARTLYLLIVAFL-CFSSMSVLHLYETFGWWRRAELFESAF 599 S+ Y +AR L +A + F+ MSVLH+YE+FGWWRRA+ + F Sbjct: 127 SLYYDRDYARFFVLETIARVPYFAFMSVLHMYESFGWWRRADYLKIHF 174 Score = 38.1 bits (87), Expect(2) = 5e-07 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLK+HF++SWNEM HL I E Sbjct: 168 DYLKIHFAESWNEMHHLLIME 188 >ref|XP_009135756.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic [Brassica rapa] Length = 354 Score = 43.9 bits (102), Expect(2) = 5e-07 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = -1 Query: 733 SYPHWFARTLYLLIVAFLCFSSMSVLHLYETFGWWRRAELFESAF 599 +YP +F I F+ MSVLH+YETFGWWRRA+ + F Sbjct: 131 TYPRFFVLET---IARVPYFAFMSVLHMYETFGWWRRADYLKVHF 172 Score = 38.5 bits (88), Expect(2) = 5e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 166 DYLKVHFAESWNEMHHLLIME 186 >ref|XP_013734008.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic-like [Brassica napus] gi|674950663|emb|CDX82927.1| BnaC01g13770D [Brassica napus] Length = 349 Score = 43.9 bits (102), Expect(2) = 5e-07 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = -1 Query: 733 SYPHWFARTLYLLIVAFLCFSSMSVLHLYETFGWWRRAELFESAF 599 +YP +F I F+ MSVLH+YETFGWWRRA+ + F Sbjct: 126 TYPRFFVLET---IARVPYFAFMSVLHMYETFGWWRRADYLKVHF 167 Score = 38.5 bits (88), Expect(2) = 5e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 161 DYLKVHFAESWNEMHHLLIME 181 >ref|XP_013617442.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic [Brassica oleracea var. oleracea] Length = 348 Score = 43.9 bits (102), Expect(2) = 5e-07 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = -1 Query: 733 SYPHWFARTLYLLIVAFLCFSSMSVLHLYETFGWWRRAELFESAF 599 +YP +F I F+ MSVLH+YETFGWWRRA+ + F Sbjct: 125 TYPRFFVLET---IARVPYFAFMSVLHMYETFGWWRRADYLKVHF 166 Score = 38.5 bits (88), Expect(2) = 5e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 160 DYLKVHFAESWNEMHHLLIME 180 >ref|XP_013672048.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic-like [Brassica napus] gi|923743746|ref|XP_013672051.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic-like [Brassica napus] gi|674954668|emb|CDX79141.1| BnaA01g12080D [Brassica napus] Length = 348 Score = 43.9 bits (102), Expect(2) = 5e-07 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = -1 Query: 733 SYPHWFARTLYLLIVAFLCFSSMSVLHLYETFGWWRRAELFESAF 599 +YP +F I F+ MSVLH+YETFGWWRRA+ + F Sbjct: 125 TYPRFFVLET---IARVPYFAFMSVLHMYETFGWWRRADYLKVHF 166 Score = 38.5 bits (88), Expect(2) = 5e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 160 DYLKVHFAESWNEMHHLLIME 180 >ref|XP_006413676.1| hypothetical protein EUTSA_v10025624mg [Eutrema salsugineum] gi|557114846|gb|ESQ55129.1| hypothetical protein EUTSA_v10025624mg [Eutrema salsugineum] Length = 346 Score = 43.9 bits (102), Expect(2) = 5e-07 Identities = 21/45 (46%), Positives = 27/45 (60%) Frame = -1 Query: 733 SYPHWFARTLYLLIVAFLCFSSMSVLHLYETFGWWRRAELFESAF 599 +YP +F I F+ MSVLH+YETFGWWRRA+ + F Sbjct: 124 TYPRFFVLET---IARVPYFAFMSVLHMYETFGWWRRADYLKVHF 165 Score = 38.5 bits (88), Expect(2) = 5e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 159 DYLKVHFAESWNEMHHLLIME 179 >ref|XP_008803504.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic-like isoform X1 [Phoenix dactylifera] Length = 141 Score = 42.0 bits (97), Expect(2) = 5e-07 Identities = 17/23 (73%), Positives = 20/23 (86%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKEVR 550 +YLKVHF++SWNEM HL I EVR Sbjct: 90 DYLKVHFAESWNEMHHLLIMEVR 112 Score = 40.4 bits (93), Expect(2) = 5e-07 Identities = 15/26 (57%), Positives = 21/26 (80%) Frame = -1 Query: 676 FSSMSVLHLYETFGWWRRAELFESAF 599 F+ +SVLH+YE+FGWWRRA+ + F Sbjct: 71 FAFISVLHMYESFGWWRRADYLKVHF 96 >ref|XP_010434065.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic-like [Camelina sativa] Length = 355 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -1 Query: 676 FSSMSVLHLYETFGWWRRAELFESAF 599 F+ MSVLH+YETFGWWRRA+ + F Sbjct: 149 FAFMSVLHMYETFGWWRRADYLKVHF 174 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 168 DYLKVHFAESWNEMHHLLIME 188 >ref|XP_006284019.1| hypothetical protein CARUB_v10005140mg [Capsella rubella] gi|482552724|gb|EOA16917.1| hypothetical protein CARUB_v10005140mg [Capsella rubella] Length = 353 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -1 Query: 676 FSSMSVLHLYETFGWWRRAELFESAF 599 F+ MSVLH+YETFGWWRRA+ + F Sbjct: 147 FAFMSVLHMYETFGWWRRADYLKVHF 172 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 166 DYLKVHFAESWNEMHHLLIME 186 >ref|XP_010448915.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic [Camelina sativa] Length = 352 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -1 Query: 676 FSSMSVLHLYETFGWWRRAELFESAF 599 F+ MSVLH+YETFGWWRRA+ + F Sbjct: 146 FAFMSVLHMYETFGWWRRADYLKVHF 171 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 165 DYLKVHFAESWNEMHHLLIME 185 >ref|XP_010439355.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic-like isoform X2 [Camelina sativa] Length = 351 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -1 Query: 676 FSSMSVLHLYETFGWWRRAELFESAF 599 F+ MSVLH+YETFGWWRRA+ + F Sbjct: 145 FAFMSVLHMYETFGWWRRADYLKVHF 170 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 164 DYLKVHFAESWNEMHHLLIME 184 >ref|XP_010439354.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic-like isoform X1 [Camelina sativa] Length = 351 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -1 Query: 676 FSSMSVLHLYETFGWWRRAELFESAF 599 F+ MSVLH+YETFGWWRRA+ + F Sbjct: 145 FAFMSVLHMYETFGWWRRADYLKVHF 170 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 164 DYLKVHFAESWNEMHHLLIME 184 >emb|CDP04461.1| unnamed protein product [Coffea canephora] Length = 351 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 24/68 (35%), Positives = 38/68 (55%), Gaps = 9/68 (13%) Frame = -1 Query: 775 IKLHASLGLFFF--------SISYPHWFARTLYLLIVAFL-CFSSMSVLHLYETFGWWRR 623 +K+ S+ +F ++ + +AR L +A + F+ MSVLHLYE+FGWWRR Sbjct: 112 VKIEQSINIFLTDSVIKILDTLYHDRHYARFFVLETIARVPYFAFMSVLHLYESFGWWRR 171 Query: 622 AELFESAF 599 A+ + F Sbjct: 172 ADYLKVHF 179 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 173 DYLKVHFAESWNEMHHLLIME 193 >emb|CAA06190.1| Immutans protein [Arabidopsis thaliana] Length = 351 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -1 Query: 676 FSSMSVLHLYETFGWWRRAELFESAF 599 F+ MSVLH+YETFGWWRRA+ + F Sbjct: 144 FAFMSVLHMYETFGWWRRADYLKVHF 169 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 163 DYLKVHFAESWNEMHHLLIME 183 >ref|NP_567658.1| alternative oxidase protein IMMUTANS [Arabidopsis thaliana] gi|85681033|sp|Q56X52.2|AOX4_ARATH RecName: Full=Ubiquinol oxidase 4, chloroplastic/chromoplastic; AltName: Full=Alternative oxidase 4; AltName: Full=Plastid terminal oxidase; AltName: Full=Protein IMMUTANS; Flags: Precursor gi|11692822|gb|AAG40014.1|AF324663_1 AT4g22260 [Arabidopsis thaliana] gi|11908102|gb|AAG41480.1|AF326898_1 unknown protein [Arabidopsis thaliana] gi|12642914|gb|AAK00399.1|AF339717_1 unknown protein [Arabidopsis thaliana] gi|4138855|gb|AAD03599.1| IMMUTANS [Arabidopsis thaliana] gi|15010796|gb|AAK74057.1| AT4g22260/T10I14_90 [Arabidopsis thaliana] gi|23308315|gb|AAN18127.1| At4g22260/T10I14_90 [Arabidopsis thaliana] gi|332659183|gb|AEE84583.1| alternative oxidase protein IMMUTANS [Arabidopsis thaliana] Length = 351 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -1 Query: 676 FSSMSVLHLYETFGWWRRAELFESAF 599 F+ MSVLH+YETFGWWRRA+ + F Sbjct: 144 FAFMSVLHMYETFGWWRRADYLKVHF 169 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 163 DYLKVHFAESWNEMHHLLIME 183 >ref|XP_002867779.1| hypothetical protein ARALYDRAFT_492640 [Arabidopsis lyrata subsp. lyrata] gi|297313615|gb|EFH44038.1| hypothetical protein ARALYDRAFT_492640 [Arabidopsis lyrata subsp. lyrata] Length = 351 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -1 Query: 676 FSSMSVLHLYETFGWWRRAELFESAF 599 F+ MSVLH+YETFGWWRRA+ + F Sbjct: 144 FAFMSVLHMYETFGWWRRADYLKVHF 169 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 163 DYLKVHFAESWNEMHHLLIME 183 >gb|KFK28796.1| hypothetical protein AALP_AA7G049400 [Arabis alpina] Length = 344 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -1 Query: 676 FSSMSVLHLYETFGWWRRAELFESAF 599 F+ MSVLH+YETFGWWRRA+ + F Sbjct: 137 FAFMSVLHMYETFGWWRRADYLKVHF 162 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 156 DYLKVHFAESWNEMHHLLIME 176 >emb|CAA16776.1| putative protein [Arabidopsis thaliana] gi|7269072|emb|CAB79181.1| putative protein [Arabidopsis thaliana] Length = 335 Score = 43.5 bits (101), Expect(2) = 6e-07 Identities = 17/26 (65%), Positives = 21/26 (80%) Frame = -1 Query: 676 FSSMSVLHLYETFGWWRRAELFESAF 599 F+ MSVLH+YETFGWWRRA+ + F Sbjct: 144 FAFMSVLHMYETFGWWRRADYLKVHF 169 Score = 38.5 bits (88), Expect(2) = 6e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 163 DYLKVHFAESWNEMHHLLIME 183 >ref|XP_011096019.1| PREDICTED: ubiquinol oxidase 4, chloroplastic/chromoplastic [Sesamum indicum] Length = 362 Score = 43.1 bits (100), Expect(2) = 8e-07 Identities = 25/68 (36%), Positives = 38/68 (55%), Gaps = 9/68 (13%) Frame = -1 Query: 775 IKLHASLGLFFF--------SISYPHWFARTLYLLIVAFL-CFSSMSVLHLYETFGWWRR 623 IKL S+ +F ++ + +AR L +A + F+ MSVLH+YE+FGWWRR Sbjct: 108 IKLEQSVNIFLTDSVIKILDTLYHDRHYARFYVLETIARVPYFAFMSVLHMYESFGWWRR 167 Query: 622 AELFESAF 599 A+ + F Sbjct: 168 ADYLKVHF 175 Score = 38.5 bits (88), Expect(2) = 8e-07 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 169 DYLKVHFAESWNEMHHLLIME 189 >emb|CBI41029.3| unnamed protein product [Vitis vinifera] Length = 2124 Score = 42.7 bits (99), Expect(2) = 1e-06 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 1/39 (2%) Frame = -1 Query: 712 RTLYLLIVAFLCFSS-MSVLHLYETFGWWRRAELFESAF 599 R L L + +C +S MSVLH+YE+FGWWRRA+ + F Sbjct: 1897 RLLILKPLFLICANSFMSVLHMYESFGWWRRADYLKVHF 1935 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = -2 Query: 618 NYLKVHFSKSWNEMRHLFIKE 556 +YLKVHF++SWNEM HL I E Sbjct: 1929 DYLKVHFAESWNEMHHLLIME 1949