BLASTX nr result
ID: Papaver29_contig00027299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00027299 (2249 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010645698.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 34 8e-06 ref|XP_002268974.1| PREDICTED: ubiquitin carboxyl-terminal hydro... 34 8e-06 >ref|XP_010645698.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24 isoform X1 [Vitis vinifera] Length = 554 Score = 33.9 bits (76), Expect(3) = 8e-06 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -2 Query: 316 TCSP*AQLLQELRVCDFLKIGYP 248 +C+P QLLQELR+ D K+GYP Sbjct: 220 SCTPFIQLLQELRIRDIPKVGYP 242 Score = 33.9 bits (76), Expect(3) = 8e-06 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = -3 Query: 75 FHPSIFEPVLNNFTPEIPNSV 13 F P++FE VL NFTP++PN + Sbjct: 276 FSPAMFEGVLKNFTPDVPNKI 296 Score = 31.2 bits (69), Expect(3) = 8e-06 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -1 Query: 155 EFVSLFETVADASLKKSQMVLTQTGMPFIP 66 EFVS F+ D SLKK + +TG PF P Sbjct: 249 EFVSEFDMPTDLSLKKKDLNGVETGRPFSP 278 >ref|XP_002268974.1| PREDICTED: ubiquitin carboxyl-terminal hydrolase 24 isoform X2 [Vitis vinifera] gi|296081305|emb|CBI17749.3| unnamed protein product [Vitis vinifera] Length = 553 Score = 33.9 bits (76), Expect(3) = 8e-06 Identities = 14/23 (60%), Positives = 18/23 (78%) Frame = -2 Query: 316 TCSP*AQLLQELRVCDFLKIGYP 248 +C+P QLLQELR+ D K+GYP Sbjct: 219 SCTPFIQLLQELRIRDIPKVGYP 241 Score = 33.9 bits (76), Expect(3) = 8e-06 Identities = 12/21 (57%), Positives = 17/21 (80%) Frame = -3 Query: 75 FHPSIFEPVLNNFTPEIPNSV 13 F P++FE VL NFTP++PN + Sbjct: 275 FSPAMFEGVLKNFTPDVPNKI 295 Score = 31.2 bits (69), Expect(3) = 8e-06 Identities = 15/30 (50%), Positives = 18/30 (60%) Frame = -1 Query: 155 EFVSLFETVADASLKKSQMVLTQTGMPFIP 66 EFVS F+ D SLKK + +TG PF P Sbjct: 248 EFVSEFDMPTDLSLKKKDLNGVETGRPFSP 277