BLASTX nr result
ID: Papaver29_contig00027199
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00027199 (431 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007159679.1| hypothetical protein PHAVU_002G258000g [Phas... 61 4e-07 gb|KHN29000.1| Putative ferric-chelate reductase 1 [Glycine soja] 60 8e-07 gb|KHN06525.1| Protein Skeletor, isoforms D/E [Glycine soja] 60 8e-07 gb|KOM30778.1| hypothetical protein LR48_Vigan01g033300 [Vigna a... 59 1e-06 gb|KRH59218.1| hypothetical protein GLYMA_05G171800 [Glycine max] 59 1e-06 ref|XP_006857170.2| PREDICTED: cytochrome b561, DM13 and DOMON d... 59 1e-06 ref|XP_010275743.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 59 1e-06 gb|ERN18637.1| hypothetical protein AMTR_s00065p00173110 [Ambore... 59 1e-06 ref|XP_003532804.1| PREDICTED: uncharacterized protein LOC100816... 59 1e-06 gb|KHN06524.1| Protein Skeletor, isoforms B/C [Glycine soja] 58 2e-06 ref|XP_003524244.1| PREDICTED: uncharacterized protein LOC100786... 58 2e-06 ref|XP_014510628.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 58 3e-06 ref|XP_007159680.1| hypothetical protein PHAVU_002G258100g [Phas... 58 3e-06 ref|XP_014510414.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 57 5e-06 ref|XP_014510413.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 57 5e-06 gb|KOM30777.1| hypothetical protein LR48_Vigan01g033200 [Vigna a... 57 5e-06 ref|XP_012843463.1| PREDICTED: cytochrome b561, DM13 and DOMON d... 57 5e-06 ref|XP_009382855.1| PREDICTED: uncharacterized protein LOC103970... 57 7e-06 ref|XP_010089955.1| hypothetical protein L484_014467 [Morus nota... 56 9e-06 ref|XP_003524243.1| PREDICTED: uncharacterized protein LOC100785... 56 9e-06 >ref|XP_007159679.1| hypothetical protein PHAVU_002G258000g [Phaseolus vulgaris] gi|561033094|gb|ESW31673.1| hypothetical protein PHAVU_002G258000g [Phaseolus vulgaris] Length = 877 Score = 60.8 bits (146), Expect = 4e-07 Identities = 29/44 (65%), Positives = 33/44 (75%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 +SNWV G I EDDS DLL S RT D ++ PS RMEVQLEPL+R Sbjct: 834 KSNWVFGNIEEDDSVDLLSSTRTTADKESLPSHRMEVQLEPLNR 877 >gb|KHN29000.1| Putative ferric-chelate reductase 1 [Glycine soja] Length = 884 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 R NWVLG + EDDS DLL RT D PS RMEVQLEPL+R Sbjct: 841 RGNWVLGNLEEDDSVDLLRPTRTIADKQLQPSARMEVQLEPLNR 884 >gb|KHN06525.1| Protein Skeletor, isoforms D/E [Glycine soja] Length = 878 Score = 59.7 bits (143), Expect = 8e-07 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 R NWVLG + EDDS DLL RT D + PS RMEVQLEPL+R Sbjct: 835 RGNWVLGNLEEDDSVDLLRPTRTSADKELQPSARMEVQLEPLNR 878 >gb|KOM30778.1| hypothetical protein LR48_Vigan01g033300 [Vigna angularis] Length = 879 Score = 59.3 bits (142), Expect = 1e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 +SNWV G + EDDS DLL S RT D ++ PS RMEVQLEPL+R Sbjct: 836 KSNWVFGNLEEDDSVDLLSSTRTTADKESLPSGRMEVQLEPLNR 879 >gb|KRH59218.1| hypothetical protein GLYMA_05G171800 [Glycine max] Length = 214 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 R NWVLG + EDDS DLL RT D PS RMEVQLEPL+R Sbjct: 171 RGNWVLGNLEEDDSVDLLRPTRTTADKQLQPSARMEVQLEPLNR 214 >ref|XP_006857170.2| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Amborella trichopoda] Length = 915 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 +SNWVLG EDDS DLLHSNR SERMEVQLEPL+R Sbjct: 872 KSNWVLGNSEEDDSVDLLHSNRVVNGRGPASSERMEVQLEPLNR 915 >ref|XP_010275743.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Nelumbo nucifera] Length = 913 Score = 58.9 bits (141), Expect = 1e-06 Identities = 30/44 (68%), Positives = 34/44 (77%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 +SNWVLG I EDDSTDLLHSN T H S++MEVQLEPL+R Sbjct: 873 KSNWVLGNIEEDDSTDLLHSNGT---QGLHSSQQMEVQLEPLNR 913 >gb|ERN18637.1| hypothetical protein AMTR_s00065p00173110 [Amborella trichopoda] Length = 892 Score = 58.9 bits (141), Expect = 1e-06 Identities = 29/44 (65%), Positives = 31/44 (70%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 +SNWVLG EDDS DLLHSNR SERMEVQLEPL+R Sbjct: 849 KSNWVLGNSEEDDSVDLLHSNRVVNGRGPASSERMEVQLEPLNR 892 >ref|XP_003532804.1| PREDICTED: uncharacterized protein LOC100816185 [Glycine max] Length = 880 Score = 58.9 bits (141), Expect = 1e-06 Identities = 28/44 (63%), Positives = 30/44 (68%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 R NWVLG + EDDS DLL RT D PS RMEVQLEPL+R Sbjct: 837 RGNWVLGNLEEDDSVDLLRPTRTTADKQLQPSARMEVQLEPLNR 880 >gb|KHN06524.1| Protein Skeletor, isoforms B/C [Glycine soja] Length = 878 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 R NWVLG + EDDS DLL S RT D + S RMEVQLEPL+R Sbjct: 835 RGNWVLGNLEEDDSVDLLRSTRTTADKELQHSARMEVQLEPLNR 878 >ref|XP_003524244.1| PREDICTED: uncharacterized protein LOC100786162 [Glycine max] gi|947110894|gb|KRH59220.1| hypothetical protein GLYMA_05G172000 [Glycine max] Length = 878 Score = 58.2 bits (139), Expect = 2e-06 Identities = 28/44 (63%), Positives = 31/44 (70%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 R NWVLG + EDDS DLL S RT D + S RMEVQLEPL+R Sbjct: 835 RGNWVLGNLEEDDSVDLLRSTRTTADKELQHSARMEVQLEPLNR 878 >ref|XP_014510628.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like [Vigna radiata var. radiata] Length = 879 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 + NWV G + EDDS DLL S RT D ++ PS RMEVQLEPL+R Sbjct: 836 KGNWVFGNLEEDDSVDLLSSTRTTADKESLPSGRMEVQLEPLNR 879 >ref|XP_007159680.1| hypothetical protein PHAVU_002G258100g [Phaseolus vulgaris] gi|561033095|gb|ESW31674.1| hypothetical protein PHAVU_002G258100g [Phaseolus vulgaris] Length = 878 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/44 (63%), Positives = 33/44 (75%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 RSNWVLG + EDDS DLL +RT + + PS RMEVQLEPL+R Sbjct: 835 RSNWVLGNLEEDDSLDLLSQSRTTANKEFLPSARMEVQLEPLNR 878 >ref|XP_014510414.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like isoform X2 [Vigna radiata var. radiata] Length = 841 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 RSNWVLG + +DDS DLL RT + + PS RMEVQLEPL+R Sbjct: 798 RSNWVLGNVEDDDSLDLLSPTRTTANKELLPSSRMEVQLEPLNR 841 >ref|XP_014510413.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830-like isoform X1 [Vigna radiata var. radiata] Length = 878 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 RSNWVLG + +DDS DLL RT + + PS RMEVQLEPL+R Sbjct: 835 RSNWVLGNVEDDDSLDLLSPTRTTANKELLPSSRMEVQLEPLNR 878 >gb|KOM30777.1| hypothetical protein LR48_Vigan01g033200 [Vigna angularis] Length = 878 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/44 (61%), Positives = 32/44 (72%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 RSNWVLG + +DDS DLL RT + + PS RMEVQLEPL+R Sbjct: 835 RSNWVLGNVEDDDSLDLLSPTRTTANKELLPSSRMEVQLEPLNR 878 >ref|XP_012843463.1| PREDICTED: cytochrome b561, DM13 and DOMON domain-containing protein At5g54830 [Erythranthe guttatus] gi|604321873|gb|EYU32377.1| hypothetical protein MIMGU_mgv1a001118mg [Erythranthe guttata] Length = 883 Score = 57.0 bits (136), Expect = 5e-06 Identities = 28/44 (63%), Positives = 34/44 (77%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 RSNWVLG GE++ DLL +R TD +++ SERMEVQLEPLSR Sbjct: 841 RSNWVLGN-GEEEDIDLLRQSRPMTDKESYSSERMEVQLEPLSR 883 >ref|XP_009382855.1| PREDICTED: uncharacterized protein LOC103970695 [Musa acuminata subsp. malaccensis] Length = 908 Score = 56.6 bits (135), Expect = 7e-06 Identities = 27/44 (61%), Positives = 31/44 (70%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 + NWVLG +DDS DLLHS RT T ++ S MEVQLEPLSR Sbjct: 865 KGNWVLGNSEDDDSVDLLHSERTVTKSESQTSGIMEVQLEPLSR 908 >ref|XP_010089955.1| hypothetical protein L484_014467 [Morus notabilis] gi|587848378|gb|EXB38651.1| hypothetical protein L484_014467 [Morus notabilis] Length = 900 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 RSNWVLG + EDDS DLL T +D ++ S RMEVQLEPL++ Sbjct: 857 RSNWVLGNLDEDDSLDLLSPTGTLSDKESQTSRRMEVQLEPLNK 900 >ref|XP_003524243.1| PREDICTED: uncharacterized protein LOC100785641 [Glycine max] gi|947110893|gb|KRH59219.1| hypothetical protein GLYMA_05G171900 [Glycine max] Length = 878 Score = 56.2 bits (134), Expect = 9e-06 Identities = 27/44 (61%), Positives = 30/44 (68%) Frame = -1 Query: 431 RSNWVLGKIGEDDSTDLLHSNRTFTDGDTHPSERMEVQLEPLSR 300 R NWVLG + EDDS DLL RT D + S RMEVQLEPL+R Sbjct: 835 RGNWVLGNLEEDDSVDLLRPTRTTADKELQHSARMEVQLEPLNR 878