BLASTX nr result
ID: Papaver29_contig00027067
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00027067 (457 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006595405.1| PREDICTED: pentatricopeptide repeat-containi... 60 8e-07 >ref|XP_006595405.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14820, mitochondrial-like [Glycine max] Length = 593 Score = 59.7 bits (143), Expect = 8e-07 Identities = 31/80 (38%), Positives = 43/80 (53%) Frame = -3 Query: 275 MASSTTAPPISYDIPTIQEEDEKEKFTDSKCAFLMVSLCPCXXXXXXXXXXXXXXXXVKF 96 MA + ++PP S+ + D+ K +SKCA+L+V+LCPC VKF Sbjct: 1 MAPAASSPPPSF---ALSIRDDHRKDEESKCAYLVVALCPCLVCFVLLLIALSIILVVKF 57 Query: 95 HLLCHTPFYNPSSLMYKKKC 36 H CHTP + SL+YKK C Sbjct: 58 HFFCHTPLH---SLLYKKNC 74