BLASTX nr result
ID: Papaver29_contig00026984
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00026984 (453 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA64173.1| soluble-starch-synthase [Solanum tuberosum] 76 9e-12 ref|XP_009785392.1| PREDICTED: soluble starch synthase 3, chloro... 76 9e-12 ref|XP_009785391.1| PREDICTED: soluble starch synthase 3, chloro... 76 9e-12 ref|XP_009594930.1| PREDICTED: soluble starch synthase 3, chloro... 76 9e-12 ref|XP_009594929.1| PREDICTED: soluble starch synthase 3, chloro... 76 9e-12 ref|XP_006348120.1| PREDICTED: soluble starch synthase isoform X... 76 9e-12 sp|Q43846.1|SSY3_SOLTU RecName: Full=Soluble starch synthase 3, ... 76 9e-12 ref|NP_001274802.1| soluble starch synthase 3, chloroplastic/amy... 76 9e-12 ref|NP_001234623.1| starch synthase III [Solanum lycopersicum] g... 76 9e-12 emb|CBI23544.3| unnamed protein product [Vitis vinifera] 75 1e-11 ref|XP_014518398.1| PREDICTED: starch synthase 3, chloroplastic/... 75 2e-11 gb|KRH11435.1| hypothetical protein GLYMA_15G108000 [Glycine max] 75 2e-11 gb|KOM53420.1| hypothetical protein LR48_Vigan09g207900 [Vigna a... 75 2e-11 ref|XP_011096061.1| PREDICTED: starch synthase 3, chloroplastic/... 75 2e-11 gb|KHN33026.1| Soluble starch synthase 3, chloroplastic/amylopla... 75 2e-11 ref|XP_006597588.1| PREDICTED: soluble starch synthase 3, chloro... 75 2e-11 ref|XP_006597587.1| PREDICTED: soluble starch synthase 3, chloro... 75 2e-11 ref|XP_006597585.1| PREDICTED: soluble starch synthase 3, chloro... 75 2e-11 ref|XP_003546152.1| PREDICTED: soluble starch synthase 3, chloro... 75 2e-11 ref|XP_003541618.1| PREDICTED: soluble starch synthase 3, chloro... 75 2e-11 >emb|CAA64173.1| soluble-starch-synthase [Solanum tuberosum] Length = 1230 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK Sbjct: 1197 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 1228 >ref|XP_009785392.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X2 [Nicotiana sylvestris] Length = 1216 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK Sbjct: 1183 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 1214 >ref|XP_009785391.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X1 [Nicotiana sylvestris] Length = 1249 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK Sbjct: 1216 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 1247 >ref|XP_009594930.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X2 [Nicotiana tomentosiformis] Length = 1210 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK Sbjct: 1177 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 1208 >ref|XP_009594929.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic isoform X1 [Nicotiana tomentosiformis] Length = 1243 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK Sbjct: 1210 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 1241 >ref|XP_006348120.1| PREDICTED: soluble starch synthase isoform X2 [Solanum tuberosum] Length = 1180 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK Sbjct: 1147 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 1178 >sp|Q43846.1|SSY3_SOLTU RecName: Full=Soluble starch synthase 3, chloroplastic/amyloplastic; AltName: Full=Soluble starch synthase III; Short=SS III; Flags: Precursor gi|1200154|emb|CAA65065.1| glycogen (starch) synthase [Solanum tuberosum] Length = 1230 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK Sbjct: 1197 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 1228 >ref|NP_001274802.1| soluble starch synthase 3, chloroplastic/amyloplastic [Solanum tuberosum] gi|254838295|gb|ACT83376.1| soluble starch synthase [Solanum tuberosum] Length = 1230 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK Sbjct: 1197 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 1228 >ref|NP_001234623.1| starch synthase III [Solanum lycopersicum] gi|247643236|gb|ACT09059.1| starch synthase III precursor [Solanum lycopersicum] Length = 1230 Score = 76.3 bits (186), Expect = 9e-12 Identities = 32/32 (100%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK Sbjct: 1197 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 1228 >emb|CBI23544.3| unnamed protein product [Vitis vinifera] Length = 83 Score = 75.5 bits (184), Expect = 1e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCKQVMEQDWSWNRPALDY+ELYHAARK Sbjct: 52 WFNSLCKQVMEQDWSWNRPALDYMELYHAARK 83 >ref|XP_014518398.1| PREDICTED: starch synthase 3, chloroplastic/amyloplastic-like [Vigna radiata var. radiata] Length = 1162 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCK+VMEQDWSWNRPALDYLELYHAARK Sbjct: 1129 WFNSLCKRVMEQDWSWNRPALDYLELYHAARK 1160 >gb|KRH11435.1| hypothetical protein GLYMA_15G108000 [Glycine max] Length = 898 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCK+VMEQDWSWNRPALDYLELYHAARK Sbjct: 865 WFNSLCKRVMEQDWSWNRPALDYLELYHAARK 896 >gb|KOM53420.1| hypothetical protein LR48_Vigan09g207900 [Vigna angularis] Length = 1165 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCK+VMEQDWSWNRPALDYLELYHAARK Sbjct: 1132 WFNSLCKRVMEQDWSWNRPALDYLELYHAARK 1163 >ref|XP_011096061.1| PREDICTED: starch synthase 3, chloroplastic/amyloplastic [Sesamum indicum] Length = 1201 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCK+VMEQDWSWNRPALDYLELYHAARK Sbjct: 1170 WFNSLCKRVMEQDWSWNRPALDYLELYHAARK 1201 >gb|KHN33026.1| Soluble starch synthase 3, chloroplastic/amyloplastic [Glycine soja] Length = 1162 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCK+VMEQDWSWNRPALDYLELYHAARK Sbjct: 1129 WFNSLCKRVMEQDWSWNRPALDYLELYHAARK 1160 >ref|XP_006597588.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like isoform X5 [Glycine max] Length = 1158 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCK+VMEQDWSWNRPALDYLELYHAARK Sbjct: 1125 WFNSLCKRVMEQDWSWNRPALDYLELYHAARK 1156 >ref|XP_006597587.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like isoform X4 [Glycine max] Length = 1168 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCK+VMEQDWSWNRPALDYLELYHAARK Sbjct: 1135 WFNSLCKRVMEQDWSWNRPALDYLELYHAARK 1166 >ref|XP_006597585.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like isoform X2 [Glycine max] gi|571517724|ref|XP_006597586.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like isoform X3 [Glycine max] Length = 1176 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCK+VMEQDWSWNRPALDYLELYHAARK Sbjct: 1143 WFNSLCKRVMEQDWSWNRPALDYLELYHAARK 1174 >ref|XP_003546152.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like isoform X1 [Glycine max] gi|947062173|gb|KRH11434.1| hypothetical protein GLYMA_15G108000 [Glycine max] Length = 1166 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCK+VMEQDWSWNRPALDYLELYHAARK Sbjct: 1133 WFNSLCKRVMEQDWSWNRPALDYLELYHAARK 1164 >ref|XP_003541618.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like isoform X1 [Glycine max] gi|571499161|ref|XP_006594421.1| PREDICTED: soluble starch synthase 3, chloroplastic/amyloplastic-like isoform X2 [Glycine max] gi|734415193|gb|KHN37605.1| Soluble starch synthase 3, chloroplastic/amyloplastic [Glycine soja] gi|947071961|gb|KRH20852.1| hypothetical protein GLYMA_13G204700 [Glycine max] gi|947071962|gb|KRH20853.1| hypothetical protein GLYMA_13G204700 [Glycine max] Length = 1149 Score = 74.7 bits (182), Expect = 2e-11 Identities = 31/32 (96%), Positives = 32/32 (100%) Frame = -1 Query: 411 WFNSLCKQVMEQDWSWNRPALDYLELYHAARK 316 WFNSLCK+VMEQDWSWNRPALDYLELYHAARK Sbjct: 1116 WFNSLCKRVMEQDWSWNRPALDYLELYHAARK 1147