BLASTX nr result
ID: Papaver29_contig00025903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00025903 (462 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAA82710.1| guanine nucleotide regulatory protein [Vicia fab... 60 5e-07 ref|XP_009776623.1| PREDICTED: ras-related protein RABA5a-like [... 59 2e-06 ref|XP_013468899.1| RAB GTPase-like protein C2B [Medicago trunca... 58 3e-06 gb|AFK34053.1| unknown [Medicago truncatula] 58 3e-06 ref|XP_004495529.1| PREDICTED: ras-related protein RABA5a [Cicer... 57 7e-06 >emb|CAA82710.1| guanine nucleotide regulatory protein [Vicia faba] gi|1098296|prf||2115367D small GTP-binding protein Length = 223 Score = 60.5 bits (145), Expect = 5e-07 Identities = 28/45 (62%), Positives = 35/45 (77%) Frame = -1 Query: 462 YNILSRKVILCQENKKQDTGWMENGKTVVLQAPNHEADSQTKRCC 328 YNILSRKV++ QE KKQDT W ENGKTVVLQ + E + ++K+ C Sbjct: 176 YNILSRKVMMSQELKKQDTPWTENGKTVVLQEGDREVEVESKKGC 220 >ref|XP_009776623.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris] gi|698577991|ref|XP_009776624.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris] gi|698577995|ref|XP_009776625.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris] gi|698577999|ref|XP_009776626.1| PREDICTED: ras-related protein RABA5a-like [Nicotiana sylvestris] Length = 225 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/48 (64%), Positives = 38/48 (79%), Gaps = 3/48 (6%) Frame = -1 Query: 462 YNILSRKVILCQENKKQDTGWMENGKTVVLQAP-NHEADSQTKR--CC 328 YNILSRKVI QE +K+D+G + NGKTVVLQA NHE D++TK+ CC Sbjct: 176 YNILSRKVIQSQELQKKDSGRLANGKTVVLQADGNHETDAETKKGGCC 223 >ref|XP_013468899.1| RAB GTPase-like protein C2B [Medicago truncatula] gi|657404164|gb|KEH42936.1| RAB GTPase-like protein C2B [Medicago truncatula] Length = 224 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/46 (60%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = -1 Query: 462 YNILSRKVILCQENKKQDTGWMENGKTVVLQAP-NHEADSQTKRCC 328 YNILSRKV++ QE KK D W+ENGKTVVLQ N A+ +TK+ C Sbjct: 176 YNILSRKVMMSQELKKDDASWIENGKTVVLQQEGNQSAEGETKKGC 221 >gb|AFK34053.1| unknown [Medicago truncatula] Length = 107 Score = 57.8 bits (138), Expect = 3e-06 Identities = 28/46 (60%), Positives = 34/46 (73%), Gaps = 1/46 (2%) Frame = -1 Query: 462 YNILSRKVILCQENKKQDTGWMENGKTVVLQAP-NHEADSQTKRCC 328 YNILSRKV++ QE KK D W+ENGKTVVLQ N A+ +TK+ C Sbjct: 59 YNILSRKVMMSQELKKDDASWIENGKTVVLQQEGNQSAEGETKKGC 104 >ref|XP_004495529.1| PREDICTED: ras-related protein RABA5a [Cicer arietinum] gi|502116643|ref|XP_004495530.1| PREDICTED: ras-related protein RABA5a [Cicer arietinum] gi|502116647|ref|XP_004495532.1| PREDICTED: ras-related protein RABA5a [Cicer arietinum] gi|502116649|ref|XP_004495533.1| PREDICTED: ras-related protein RABA5a [Cicer arietinum] gi|828304239|ref|XP_012570006.1| PREDICTED: ras-related protein RABA5a [Cicer arietinum] Length = 225 Score = 56.6 bits (135), Expect = 7e-06 Identities = 28/47 (59%), Positives = 35/47 (74%), Gaps = 2/47 (4%) Frame = -1 Query: 462 YNILSRKVILCQENKKQDTGWMENGKTVVLQA--PNHEADSQTKRCC 328 YNILSRKV++ QE KQD W+ENGKTVVLQ EA+++TK+ C Sbjct: 176 YNILSRKVMMSQELNKQDPSWIENGKTVVLQEGDKEKEAEAETKKGC 222