BLASTX nr result
ID: Papaver29_contig00025559
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00025559 (663 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006383741.1| hypothetical protein POPTR_0005s26070g [Popu... 79 3e-12 ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus t... 79 3e-12 sp|P27490.1|CB28_PEA RecName: Full=Chlorophyll a-b binding prote... 78 4e-12 ref|XP_012830273.1| PREDICTED: chlorophyll a-b binding protein o... 78 4e-12 gb|EYU43289.1| hypothetical protein MIMGU_mgv11b019945mg [Erythr... 78 4e-12 ref|XP_012830260.1| PREDICTED: chlorophyll a-b binding protein o... 78 4e-12 ref|XP_012830259.1| PREDICTED: chlorophyll a-b binding protein o... 78 4e-12 dbj|BAH70299.1| chlorophyll a/b binding protein [Vicia cinerea] 78 4e-12 gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisu... 78 4e-12 gb|AAW31511.1| light-harvesting chlorophyll-a/b binding protein ... 78 4e-12 ref|XP_009611577.1| PREDICTED: chlorophyll a-b binding protein 4... 77 7e-12 ref|XP_009377344.1| PREDICTED: chlorophyll a-b binding protein o... 77 7e-12 ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus t... 77 7e-12 pdb|1VCR|A Chain A, An Icosahedral Assembly Of Light-Harvesting ... 77 9e-12 dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein... 77 9e-12 sp|P27496.1|CB25_TOBAC RecName: Full=Chlorophyll a-b binding pro... 77 9e-12 sp|P04783.1|CB25_PETSP RecName: Full=Chlorophyll a-b binding pro... 77 9e-12 ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloro... 77 9e-12 sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding pro... 77 9e-12 ref|XP_009775649.1| PREDICTED: chlorophyll a-b binding protein 2... 77 9e-12 >ref|XP_006383741.1| hypothetical protein POPTR_0005s26070g [Populus trichocarpa] gi|550339766|gb|ERP61538.1| hypothetical protein POPTR_0005s26070g [Populus trichocarpa] Length = 206 Score = 78.6 bits (192), Expect = 3e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHLSDPVNNNAW+YATNFAPGK Sbjct: 171 QAIVTGKGPLENLADHLSDPVNNNAWAYATNFAPGK 206 >ref|XP_002307725.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa] gi|118485884|gb|ABK94788.1| unknown [Populus trichocarpa] gi|222857174|gb|EEE94721.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa] Length = 264 Score = 78.6 bits (192), Expect = 3e-12 Identities = 35/36 (97%), Positives = 36/36 (100%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHLSDPVNNNAW+YATNFAPGK Sbjct: 229 QAIVTGKGPLENLADHLSDPVNNNAWAYATNFAPGK 264 >sp|P27490.1|CB28_PEA RecName: Full=Chlorophyll a-b binding protein 8, chloroplastic; AltName: Full=LHCII type I CAB-8; Flags: Precursor gi|20669|emb|CAA39883.1| chlorophyll a/b binding protein [Pisum sativum] Length = 268 Score = 78.2 bits (191), Expect = 4e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 233 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 268 >ref|XP_012830273.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Erythranthe guttatus] Length = 272 Score = 78.2 bits (191), Expect = 4e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 237 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 272 >gb|EYU43289.1| hypothetical protein MIMGU_mgv11b019945mg [Erythranthe guttata] Length = 265 Score = 78.2 bits (191), Expect = 4e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 230 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 265 >ref|XP_012830260.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Erythranthe guttatus] gi|604344525|gb|EYU43279.1| hypothetical protein MIMGU_mgv1a011871mg [Erythranthe guttata] Length = 268 Score = 78.2 bits (191), Expect = 4e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 233 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 268 >ref|XP_012830259.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Erythranthe guttatus] gi|604344524|gb|EYU43278.1| hypothetical protein MIMGU_mgv1a011933mg [Erythranthe guttata] Length = 266 Score = 78.2 bits (191), Expect = 4e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 231 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 266 >dbj|BAH70299.1| chlorophyll a/b binding protein [Vicia cinerea] Length = 266 Score = 78.2 bits (191), Expect = 4e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 231 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 266 >gb|ABN49454.2| chloroplast chlorophyll a/b binding protein [Pisum sativum] Length = 266 Score = 78.2 bits (191), Expect = 4e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 231 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 266 >gb|AAW31511.1| light-harvesting chlorophyll-a/b binding protein Lhcb1 [Pisum sativum] Length = 266 Score = 78.2 bits (191), Expect = 4e-12 Identities = 35/36 (97%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHLSDPVNNNAWSYATNF PGK Sbjct: 231 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFVPGK 266 >ref|XP_009611577.1| PREDICTED: chlorophyll a-b binding protein 40, chloroplastic-like [Nicotiana tomentosiformis] Length = 262 Score = 77.4 bits (189), Expect = 7e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHL+DPVNNNAW+YATNFAPGK Sbjct: 227 QAIVTGKGPLENLADHLADPVNNNAWAYATNFAPGK 262 >ref|XP_009377344.1| PREDICTED: chlorophyll a-b binding protein of LHCII type 1-like [Pyrus x bretschneideri] Length = 267 Score = 77.4 bits (189), Expect = 7e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGP+ENLADHLSDPVNNNAWSYATNF PGK Sbjct: 232 QAIVTGKGPIENLADHLSDPVNNNAWSYATNFVPGK 267 >ref|XP_002316737.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa] gi|222859802|gb|EEE97349.1| Chlorophyll a-b binding protein 2 [Populus trichocarpa] Length = 264 Score = 77.4 bits (189), Expect = 7e-12 Identities = 34/36 (94%), Positives = 36/36 (100%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHL+DPVNNNAW+YATNFAPGK Sbjct: 229 QAIVTGKGPLENLADHLADPVNNNAWAYATNFAPGK 264 >pdb|1VCR|A Chain A, An Icosahedral Assembly Of Light-Harvesting Chlorophyll AB Protein Complex From Pea Thylakoid Membranes Length = 232 Score = 77.0 bits (188), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 197 QAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 232 >dbj|BAA25389.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 265 Score = 77.0 bits (188), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 230 QAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 265 >sp|P27496.1|CB25_TOBAC RecName: Full=Chlorophyll a-b binding protein 50, chloroplastic; AltName: Full=LHCII type I CAB-50; Short=LHCP; Flags: Precursor gi|19833|emb|CAA36956.1| unnamed protein product [Nicotiana tabacum] Length = 267 Score = 77.0 bits (188), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 232 QAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 267 >sp|P04783.1|CB25_PETSP RecName: Full=Chlorophyll a-b binding protein 91R, chloroplastic; AltName: Full=LHCII type I CAB-91R; Short=LHCP; Flags: Precursor gi|20487|emb|CAA26209.1| unnamed protein product [Petunia sp.] Length = 267 Score = 77.0 bits (188), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 232 QAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 267 >ref|NP_001266111.1| chlorophyll a-b binding protein AB80, chloroplastic-like [Cicer arietinum] gi|3928140|emb|CAA10284.1| chlorophyll a/b binding protein [Cicer arietinum] Length = 266 Score = 77.0 bits (188), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHLSDPVNNNAW+YATNF PGK Sbjct: 231 QAIVTGKGPLENLADHLSDPVNNNAWAYATNFVPGK 266 >sp|P27492.1|CB21_TOBAC RecName: Full=Chlorophyll a-b binding protein 16, chloroplastic; AltName: Full=LHCII type I CAB-16; Short=LHCP; Flags: Precursor gi|19819|emb|CAA36955.1| unnamed protein product [Nicotiana tabacum] Length = 266 Score = 77.0 bits (188), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 231 QAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 266 >ref|XP_009775649.1| PREDICTED: chlorophyll a-b binding protein 21, chloroplastic-like [Nicotiana sylvestris] gi|3036945|dbj|BAA25390.1| light harvesting chlorophyll a/b-binding protein [Nicotiana sylvestris] Length = 265 Score = 77.0 bits (188), Expect = 9e-12 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = -3 Query: 661 QAIVTGKGPLENLADHLSDPVNNNAWSYATNFAPGK 554 QAIVTGKGPLENLADHL+DPVNNNAWSYATNF PGK Sbjct: 230 QAIVTGKGPLENLADHLADPVNNNAWSYATNFVPGK 265