BLASTX nr result
ID: Papaver29_contig00025472
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00025472 (653 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010554676.1| PREDICTED: clathrin heavy chain 1-like [Tare... 63 1e-07 ref|XP_006403036.1| hypothetical protein EUTSA_v10005737mg [Eutr... 63 2e-07 ref|XP_006355648.1| PREDICTED: clathrin heavy chain 1-like [Sola... 62 2e-07 ref|XP_004239947.1| PREDICTED: clathrin heavy chain 1-like [Sola... 62 2e-07 ref|XP_009758522.1| PREDICTED: clathrin heavy chain 1 [Nicotiana... 62 3e-07 ref|XP_009631458.1| PREDICTED: clathrin heavy chain 1 [Nicotiana... 62 3e-07 ref|XP_010999397.1| PREDICTED: clathrin heavy chain 2 isoform X3... 62 4e-07 ref|XP_010999322.1| PREDICTED: clathrin heavy chain 1 isoform X2... 62 4e-07 ref|XP_011048924.1| PREDICTED: clathrin heavy chain 1 isoform X1... 62 4e-07 ref|XP_010534608.1| PREDICTED: clathrin heavy chain 2-like [Tare... 62 4e-07 ref|XP_002311238.2| clathrin heavy chain family protein [Populus... 62 4e-07 gb|EPS62652.1| hypothetical protein M569_12138, partial [Genlise... 62 4e-07 ref|XP_012087093.1| PREDICTED: clathrin heavy chain 1 isoform X1... 61 5e-07 gb|KDO68931.1| hypothetical protein CISIN_1g000428mg [Citrus sin... 61 5e-07 ref|XP_012850085.1| PREDICTED: clathrin heavy chain 1 [Erythrant... 61 5e-07 ref|XP_006435764.1| hypothetical protein CICLE_v10030488mg [Citr... 61 5e-07 ref|XP_011076674.1| PREDICTED: LOW QUALITY PROTEIN: clathrin hea... 61 7e-07 gb|KHG02496.1| Clathrin heavy chain 2 [Gossypium arboreum] 61 7e-07 gb|KHG02495.1| Clathrin heavy chain 2 [Gossypium arboreum] 61 7e-07 ref|XP_007008929.1| Clathrin, heavy chain isoform 6 [Theobroma c... 61 7e-07 >ref|XP_010554676.1| PREDICTED: clathrin heavy chain 1-like [Tarenaya hassleriana] Length = 1708 Score = 63.2 bits (152), Expect = 1e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E V Y + Sbjct: 281 HKYGLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTAEASTVGGFYAI 331 >ref|XP_006403036.1| hypothetical protein EUTSA_v10005737mg [Eutrema salsugineum] gi|557104135|gb|ESQ44489.1| hypothetical protein EUTSA_v10005737mg [Eutrema salsugineum] Length = 1712 Score = 62.8 bits (151), Expect = 2e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E V Y + Sbjct: 281 HKYGLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEAQSVGGFYAI 331 >ref|XP_006355648.1| PREDICTED: clathrin heavy chain 1-like [Solanum tuberosum] Length = 1707 Score = 62.4 bits (150), Expect = 2e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E + Y V Sbjct: 281 HKYGLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSIGGFYAV 331 >ref|XP_004239947.1| PREDICTED: clathrin heavy chain 1-like [Solanum lycopersicum] Length = 1706 Score = 62.4 bits (150), Expect = 2e-07 Identities = 31/51 (60%), Positives = 35/51 (68%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E + Y V Sbjct: 281 HKYGLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSIGGFYAV 331 >ref|XP_009758522.1| PREDICTED: clathrin heavy chain 1 [Nicotiana sylvestris] Length = 1707 Score = 62.0 bits (149), Expect = 3e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E + Y + Sbjct: 281 HKYGLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSIGGFYAI 331 >ref|XP_009631458.1| PREDICTED: clathrin heavy chain 1 [Nicotiana tomentosiformis] Length = 1702 Score = 62.0 bits (149), Expect = 3e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E + Y + Sbjct: 281 HKYGLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSIGGFYAI 331 >ref|XP_010999397.1| PREDICTED: clathrin heavy chain 2 isoform X3 [Populus euphratica] Length = 1710 Score = 61.6 bits (148), Expect = 4e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E +V Y + Sbjct: 281 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTAEASVVGGFYAI 331 >ref|XP_010999322.1| PREDICTED: clathrin heavy chain 1 isoform X2 [Populus euphratica] Length = 1605 Score = 61.6 bits (148), Expect = 4e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E +V Y + Sbjct: 181 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTAEASVVGGFYAI 231 >ref|XP_011048924.1| PREDICTED: clathrin heavy chain 1 isoform X1 [Populus euphratica] Length = 1705 Score = 61.6 bits (148), Expect = 4e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E +V Y + Sbjct: 281 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTAEASVVGGFYAI 331 >ref|XP_010534608.1| PREDICTED: clathrin heavy chain 2-like [Tarenaya hassleriana] Length = 1720 Score = 61.6 bits (148), Expect = 4e-07 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+YGL+Y I K LLFVY ET AVY NRISPDP+FLT E V Y + Sbjct: 281 HKYGLIYAITKLGLLFVYDLETATAVYRNRISPDPIFLTAEASAVGGFYAI 331 >ref|XP_002311238.2| clathrin heavy chain family protein [Populus trichocarpa] gi|550332584|gb|EEE88605.2| clathrin heavy chain family protein [Populus trichocarpa] Length = 1705 Score = 61.6 bits (148), Expect = 4e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E +V Y + Sbjct: 281 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTAEASVVGGFYAI 331 >gb|EPS62652.1| hypothetical protein M569_12138, partial [Genlisea aurea] Length = 493 Score = 61.6 bits (148), Expect = 4e-07 Identities = 30/45 (66%), Positives = 33/45 (73%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLV 346 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E V Sbjct: 298 HKYGLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTAEASSV 342 >ref|XP_012087093.1| PREDICTED: clathrin heavy chain 1 isoform X1 [Jatropha curcas] gi|802546809|ref|XP_012087101.1| PREDICTED: clathrin heavy chain 1 isoform X2 [Jatropha curcas] gi|643738925|gb|KDP44739.1| hypothetical protein JCGZ_01239 [Jatropha curcas] Length = 1706 Score = 61.2 bits (147), Expect = 5e-07 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E V Y + Sbjct: 281 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTAEASSVGGFYSI 331 >gb|KDO68931.1| hypothetical protein CISIN_1g000428mg [Citrus sinensis] Length = 1520 Score = 61.2 bits (147), Expect = 5e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E + Y + Sbjct: 281 HKYGLIYVITKLGLLFVYDLETAAAVYRNRISPDPIFLTSEASSLGGFYAI 331 >ref|XP_012850085.1| PREDICTED: clathrin heavy chain 1 [Erythranthe guttatus] gi|604313636|gb|EYU26805.1| hypothetical protein MIMGU_mgv1a000127mg [Erythranthe guttata] Length = 1709 Score = 61.2 bits (147), Expect = 5e-07 Identities = 32/51 (62%), Positives = 34/51 (66%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+Y LLYVI K LLFVY ET AVY NRISPDP+FLT E V Y V Sbjct: 281 HKYSLLYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSVGGFYAV 331 >ref|XP_006435764.1| hypothetical protein CICLE_v10030488mg [Citrus clementina] gi|568865883|ref|XP_006486297.1| PREDICTED: clathrin heavy chain 1-like [Citrus sinensis] gi|557537960|gb|ESR49004.1| hypothetical protein CICLE_v10030488mg [Citrus clementina] Length = 1701 Score = 61.2 bits (147), Expect = 5e-07 Identities = 30/51 (58%), Positives = 35/51 (68%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+YGL+YVI K LLFVY ET AVY NRISPDP+FLT E + Y + Sbjct: 281 HKYGLIYVITKLGLLFVYDLETAAAVYRNRISPDPIFLTSEASSLGGFYAI 331 >ref|XP_011076674.1| PREDICTED: LOW QUALITY PROTEIN: clathrin heavy chain 1-like [Sesamum indicum] Length = 1706 Score = 60.8 bits (146), Expect = 7e-07 Identities = 31/51 (60%), Positives = 34/51 (66%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E V Y V Sbjct: 281 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTAEASSVGGFYAV 331 >gb|KHG02496.1| Clathrin heavy chain 2 [Gossypium arboreum] Length = 1257 Score = 60.8 bits (146), Expect = 7e-07 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E L Y + Sbjct: 225 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASLAGGFYAI 275 >gb|KHG02495.1| Clathrin heavy chain 2 [Gossypium arboreum] Length = 1323 Score = 60.8 bits (146), Expect = 7e-07 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E L Y + Sbjct: 260 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASLAGGFYAI 310 >ref|XP_007008929.1| Clathrin, heavy chain isoform 6 [Theobroma cacao] gi|508725842|gb|EOY17739.1| Clathrin, heavy chain isoform 6 [Theobroma cacao] Length = 1207 Score = 60.8 bits (146), Expect = 7e-07 Identities = 30/51 (58%), Positives = 34/51 (66%) Frame = -3 Query: 480 HRYGLLYVIRKF*LLFVYGWETTIAVYINRISPDPLFLTIEVMLVRCLYDV 328 H+Y L+YVI K LLFVY ET AVY NRISPDP+FLT E V Y + Sbjct: 91 HKYSLIYVITKLGLLFVYDLETATAVYRNRISPDPIFLTSEASSVGGFYSI 141