BLASTX nr result
ID: Papaver29_contig00025171
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00025171 (548 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP07725.1| unnamed protein product [Coffea canephora] 73 7e-11 ref|XP_011462553.1| PREDICTED: clustered mitochondria protein [F... 73 1e-10 ref|XP_011087269.1| PREDICTED: clustered mitochondria protein [S... 73 1e-10 ref|XP_010659324.1| PREDICTED: clustered mitochondria protein [V... 72 1e-10 ref|XP_007052586.1| Tetratricopeptide repeat-containing protein ... 72 1e-10 ref|XP_007052585.1| Tetratricopeptide repeat-containing protein ... 72 1e-10 ref|XP_013442090.1| translation initiation factor, putative [Med... 72 2e-10 gb|KOM42878.1| hypothetical protein LR48_Vigan05g048200 [Vigna a... 72 2e-10 ref|XP_010102634.1| Protein KIAA0664-like protein [Morus notabil... 72 2e-10 ref|XP_010695371.1| PREDICTED: clustered mitochondria protein [B... 72 2e-10 ref|XP_007149054.1| hypothetical protein PHAVU_005G037000g [Phas... 72 2e-10 ref|XP_010257387.1| PREDICTED: clustered mitochondria protein is... 71 3e-10 ref|XP_010257386.1| PREDICTED: clustered mitochondria protein is... 71 3e-10 ref|XP_010257385.1| PREDICTED: clustered mitochondria protein is... 71 3e-10 ref|XP_012065515.1| PREDICTED: clustered mitochondria protein [J... 71 4e-10 ref|XP_011007356.1| PREDICTED: clustered mitochondria protein [P... 70 5e-10 ref|XP_002314036.2| hypothetical protein POPTR_0009s069801g, par... 70 5e-10 gb|KHN49026.1| Protein KIAA0664-like protein [Glycine soja] 70 6e-10 gb|KHN29207.1| Protein KIAA0664-like protein [Glycine soja] 70 6e-10 ref|XP_010426817.1| PREDICTED: clustered mitochondria protein-li... 70 6e-10 >emb|CDP07725.1| unnamed protein product [Coffea canephora] Length = 1416 Score = 73.2 bits (178), Expect = 7e-11 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADEENVRKA YLKDV+LPKF+QDLCTLEVSPMDG L Sbjct: 797 EEIAADEENVRKASLYLKDVLLPKFIQDLCTLEVSPMDGHTL 838 >ref|XP_011462553.1| PREDICTED: clustered mitochondria protein [Fragaria vesca subsp. vesca] Length = 1423 Score = 72.8 bits (177), Expect = 1e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+A DEENVRKA SYL DVVLPKF+QDLCTLEVSPMDG L Sbjct: 774 EEIATDEENVRKASSYLTDVVLPKFIQDLCTLEVSPMDGQTL 815 >ref|XP_011087269.1| PREDICTED: clustered mitochondria protein [Sesamum indicum] Length = 1433 Score = 72.8 bits (177), Expect = 1e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+A DEENVRKA YLKDVVLPKF+QDLCTLEVSPMDG L Sbjct: 789 EEIATDEENVRKASLYLKDVVLPKFIQDLCTLEVSPMDGQTL 830 >ref|XP_010659324.1| PREDICTED: clustered mitochondria protein [Vitis vinifera] gi|297736213|emb|CBI24851.3| unnamed protein product [Vitis vinifera] Length = 1445 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADEENVRKA S+L DVVLPKF+QDLCTLEVSPMDG L Sbjct: 780 EEIAADEENVRKASSHLTDVVLPKFIQDLCTLEVSPMDGQTL 821 >ref|XP_007052586.1| Tetratricopeptide repeat-containing protein isoform 2, partial [Theobroma cacao] gi|508704847|gb|EOX96743.1| Tetratricopeptide repeat-containing protein isoform 2, partial [Theobroma cacao] Length = 1350 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADEENVRK SYL DVVLPKF+QDLCTLEVSPMDG L Sbjct: 780 EEIAADEENVRKVSSYLLDVVLPKFIQDLCTLEVSPMDGQTL 821 >ref|XP_007052585.1| Tetratricopeptide repeat-containing protein isoform 1 [Theobroma cacao] gi|508704846|gb|EOX96742.1| Tetratricopeptide repeat-containing protein isoform 1 [Theobroma cacao] Length = 1428 Score = 72.4 bits (176), Expect = 1e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADEENVRK SYL DVVLPKF+QDLCTLEVSPMDG L Sbjct: 780 EEIAADEENVRKVSSYLLDVVLPKFIQDLCTLEVSPMDGQTL 821 >ref|XP_013442090.1| translation initiation factor, putative [Medicago truncatula] gi|657369815|gb|KEH16115.1| translation initiation factor, putative [Medicago truncatula] Length = 597 Score = 72.0 bits (175), Expect = 2e-10 Identities = 33/39 (84%), Positives = 35/39 (89%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDG 304 +E+AADEENVRK G YL DV LPKFVQDLCTLEVSPMDG Sbjct: 398 EEIAADEENVRKVGQYLTDVALPKFVQDLCTLEVSPMDG 436 >gb|KOM42878.1| hypothetical protein LR48_Vigan05g048200 [Vigna angularis] Length = 1395 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADE+NVRK G YL DVVLPKF+QDLCTLEVSPMDG L Sbjct: 805 EEIAADEDNVRKVGQYLIDVVLPKFIQDLCTLEVSPMDGQTL 846 >ref|XP_010102634.1| Protein KIAA0664-like protein [Morus notabilis] gi|587905644|gb|EXB93784.1| Protein KIAA0664-like protein [Morus notabilis] Length = 1398 Score = 71.6 bits (174), Expect = 2e-10 Identities = 34/42 (80%), Positives = 37/42 (88%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AAD+ENVRK SYL DVVLPKFVQDLCTLEVSPMDG L Sbjct: 749 EEIAADKENVRKVSSYLTDVVLPKFVQDLCTLEVSPMDGQTL 790 >ref|XP_010695371.1| PREDICTED: clustered mitochondria protein [Beta vulgaris subsp. vulgaris] gi|731316400|ref|XP_010695380.1| PREDICTED: clustered mitochondria protein [Beta vulgaris subsp. vulgaris] gi|870867979|gb|KMT18848.1| hypothetical protein BVRB_2g029530 [Beta vulgaris subsp. vulgaris] Length = 1445 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/42 (78%), Positives = 38/42 (90%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 QE+A+DE+NV+KA SYL DVVLPKF+QDLCTLEVSPMDG L Sbjct: 817 QEIASDEDNVQKASSYLTDVVLPKFIQDLCTLEVSPMDGQTL 858 >ref|XP_007149054.1| hypothetical protein PHAVU_005G037000g [Phaseolus vulgaris] gi|561022318|gb|ESW21048.1| hypothetical protein PHAVU_005G037000g [Phaseolus vulgaris] Length = 1434 Score = 71.6 bits (174), Expect = 2e-10 Identities = 33/42 (78%), Positives = 37/42 (88%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADE+NVRK G YL DVVLPKF+QDLCTLEVSPMDG L Sbjct: 787 EEIAADEDNVRKVGQYLIDVVLPKFIQDLCTLEVSPMDGQTL 828 >ref|XP_010257387.1| PREDICTED: clustered mitochondria protein isoform X3 [Nelumbo nucifera] Length = 1314 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADEE VRKAG YLK+VVLPKFVQDLC+LEVSPMDG L Sbjct: 665 EEIAADEEGVRKAGLYLKNVVLPKFVQDLCSLEVSPMDGQTL 706 >ref|XP_010257386.1| PREDICTED: clustered mitochondria protein isoform X2 [Nelumbo nucifera] Length = 1415 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADEE VRKAG YLK+VVLPKFVQDLC+LEVSPMDG L Sbjct: 766 EEIAADEEGVRKAGLYLKNVVLPKFVQDLCSLEVSPMDGQTL 807 >ref|XP_010257385.1| PREDICTED: clustered mitochondria protein isoform X1 [Nelumbo nucifera] Length = 1416 Score = 71.2 bits (173), Expect = 3e-10 Identities = 34/42 (80%), Positives = 38/42 (90%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADEE VRKAG YLK+VVLPKFVQDLC+LEVSPMDG L Sbjct: 767 EEIAADEEGVRKAGLYLKNVVLPKFVQDLCSLEVSPMDGQTL 808 >ref|XP_012065515.1| PREDICTED: clustered mitochondria protein [Jatropha curcas] gi|643737319|gb|KDP43431.1| hypothetical protein JCGZ_16718 [Jatropha curcas] Length = 1423 Score = 70.9 bits (172), Expect = 4e-10 Identities = 33/42 (78%), Positives = 36/42 (85%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+A DEENVRKA SYL D VLPKF+QDLCTLEVSPMDG L Sbjct: 778 EEIAKDEENVRKASSYLADTVLPKFIQDLCTLEVSPMDGQTL 819 >ref|XP_011007356.1| PREDICTED: clustered mitochondria protein [Populus euphratica] gi|743926392|ref|XP_011007357.1| PREDICTED: clustered mitochondria protein [Populus euphratica] Length = 1422 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADEENV+K GSYL + VLPKF+QDLCTLEVSPMDG L Sbjct: 777 EEIAADEENVKKVGSYLANTVLPKFIQDLCTLEVSPMDGQTL 818 >ref|XP_002314036.2| hypothetical protein POPTR_0009s069801g, partial [Populus trichocarpa] gi|550331209|gb|EEE87991.2| hypothetical protein POPTR_0009s069801g, partial [Populus trichocarpa] Length = 798 Score = 70.5 bits (171), Expect = 5e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADEENV+K GSYL + VLPKF+QDLCTLEVSPMDG L Sbjct: 128 EEIAADEENVKKVGSYLANTVLPKFIQDLCTLEVSPMDGQTL 169 >gb|KHN49026.1| Protein KIAA0664-like protein [Glycine soja] Length = 1415 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADE+NVRK YL DVVLPKF+QDLCTLEVSPMDG L Sbjct: 758 EEIAADEDNVRKVSQYLTDVVLPKFIQDLCTLEVSPMDGQTL 799 >gb|KHN29207.1| Protein KIAA0664-like protein [Glycine soja] Length = 1429 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/42 (76%), Positives = 36/42 (85%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADE+NVRK YL DVVLPKF+QDLCTLEVSPMDG L Sbjct: 791 EEIAADEDNVRKVSQYLTDVVLPKFIQDLCTLEVSPMDGQTL 832 >ref|XP_010426817.1| PREDICTED: clustered mitochondria protein-like [Camelina sativa] Length = 1407 Score = 70.1 bits (170), Expect = 6e-10 Identities = 32/42 (76%), Positives = 37/42 (88%) Frame = -3 Query: 420 QELAADEENVRKAGSYLKDVVLPKFVQDLCTLEVSPMDGGLL 295 +E+AADEENV+K SYL DVVLPKF++DLCTLEVSPMDG L Sbjct: 784 EEIAADEENVKKVSSYLVDVVLPKFIEDLCTLEVSPMDGQTL 825