BLASTX nr result
ID: Papaver29_contig00024568
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00024568 (582 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002515319.1| conserved hypothetical protein [Ricinus comm... 60 1e-06 >ref|XP_002515319.1| conserved hypothetical protein [Ricinus communis] gi|223545799|gb|EEF47303.1| conserved hypothetical protein [Ricinus communis] Length = 83 Score = 59.7 bits (143), Expect = 1e-06 Identities = 30/65 (46%), Positives = 41/65 (63%) Frame = -3 Query: 490 MASKKENTQTTTTHMNDDQEEGETERSSNIEATRQSHIGKAIAQRALYGSNRRRIGSRKG 311 MA++K N + + TH + +QE+ S++ E T GKA+A RALYGS+ RR GSRK Sbjct: 1 MATEKANAEVSNTHTDGNQEKSAESSSNSKEFTAPPRFGKALAHRALYGSSSRRAGSRKV 60 Query: 310 VKNDT 296 NDT Sbjct: 61 RDNDT 65