BLASTX nr result
ID: Papaver29_contig00023857
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00023857 (669 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010249955.1| PREDICTED: pentatricopeptide repeat-containi... 68 4e-09 >ref|XP_010249955.1| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic-like [Nelumbo nucifera] Length = 718 Score = 68.2 bits (165), Expect = 4e-09 Identities = 46/106 (43%), Positives = 58/106 (54%), Gaps = 11/106 (10%) Frame = +2 Query: 2 RTGLISHVFFTSKVVAFCALEDSG-------LITQIPNLTPSIHLQLYNLR*ILAKT--- 151 RTGLI HVF+ SK+V+FCAL+DSG + +QI N TP I + +R K Sbjct: 73 RTGLIFHVFYASKIVSFCALDDSGSLHYARLVFSQISNPTPFICNSI--IRGYTNKNFPH 130 Query: 152 -PIFFYQGMTENGLFQENFTFPSLSNSTICDSYMNS*RGNALHCFT 286 I FY+ M E GL +NFTFPSL S C G LHC++ Sbjct: 131 QAILFYREMIEEGLLPDNFTFPSLFKS--CGDLN---EGKQLHCYS 171