BLASTX nr result
ID: Papaver29_contig00023768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00023768 (655 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_014513818.1| PREDICTED: cell division cycle protein 48 ho... 72 3e-10 ref|XP_014513817.1| PREDICTED: cell division cycle protein 48 ho... 72 3e-10 gb|KOM35182.1| hypothetical protein LR48_Vigan02g133200 [Vigna a... 72 3e-10 gb|KOM35181.1| hypothetical protein LR48_Vigan02g133100 [Vigna a... 72 3e-10 ref|XP_010107503.1| Cell division cycle protein 48-like protein ... 72 3e-10 gb|KHN48262.1| Cell division cycle protein 48 like [Glycine soja] 72 3e-10 gb|KHN39040.1| Cell division cycle protein 48 like [Glycine soja] 72 3e-10 gb|KHN09517.1| Cell division cycle protein 48 like [Glycine soja] 72 3e-10 ref|XP_009334653.1| PREDICTED: cell division control protein 48 ... 72 3e-10 ref|XP_009376815.1| PREDICTED: cell division control protein 48 ... 72 3e-10 ref|XP_008359643.1| PREDICTED: cell division control protein 48 ... 72 3e-10 ref|XP_008350361.1| PREDICTED: cell division control protein 48 ... 72 3e-10 ref|XP_003625676.2| ATPase, AAA-type, CDC48 protein [Medicago tr... 72 3e-10 ref|XP_008243978.1| PREDICTED: cell division control protein 48 ... 72 3e-10 ref|XP_007144357.1| hypothetical protein PHAVU_007G149400g [Phas... 72 3e-10 ref|XP_004497529.1| PREDICTED: cell division cycle protein 48 ho... 72 3e-10 ref|XP_004493989.1| PREDICTED: cell division control protein 48 ... 72 3e-10 gb|EMT26392.1| Cell division control 48-E-like protein [Aegilops... 72 3e-10 gb|EMS47029.1| Cell division cycle protein 48-like protein [Trit... 72 3e-10 ref|XP_007211349.1| hypothetical protein PRUPE_ppa001545mg [Prun... 72 3e-10 >ref|XP_014513818.1| PREDICTED: cell division cycle protein 48 homolog [Vigna radiata var. radiata] Length = 809 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 560 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 595 >ref|XP_014513817.1| PREDICTED: cell division cycle protein 48 homolog [Vigna radiata var. radiata] Length = 809 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 560 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 595 >gb|KOM35182.1| hypothetical protein LR48_Vigan02g133200 [Vigna angularis] Length = 795 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 546 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 581 >gb|KOM35181.1| hypothetical protein LR48_Vigan02g133100 [Vigna angularis] Length = 795 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 546 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 581 >ref|XP_010107503.1| Cell division cycle protein 48-like protein [Morus notabilis] gi|587929010|gb|EXC16185.1| Cell division cycle protein 48-like protein [Morus notabilis] Length = 791 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 546 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 581 >gb|KHN48262.1| Cell division cycle protein 48 like [Glycine soja] Length = 811 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 560 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 595 >gb|KHN39040.1| Cell division cycle protein 48 like [Glycine soja] Length = 813 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 562 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 597 >gb|KHN09517.1| Cell division cycle protein 48 like [Glycine soja] Length = 720 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 472 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 507 >ref|XP_009334653.1| PREDICTED: cell division control protein 48 homolog D [Pyrus x bretschneideri] Length = 806 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 560 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 595 >ref|XP_009376815.1| PREDICTED: cell division control protein 48 homolog D-like [Pyrus x bretschneideri] Length = 806 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 560 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 595 >ref|XP_008359643.1| PREDICTED: cell division control protein 48 homolog D [Malus domestica] Length = 806 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 560 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 595 >ref|XP_008350361.1| PREDICTED: cell division control protein 48 homolog D [Malus domestica] Length = 806 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 560 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 595 >ref|XP_003625676.2| ATPase, AAA-type, CDC48 protein [Medicago truncatula] gi|657379715|gb|AES81894.2| ATPase, AAA-type, CDC48 protein [Medicago truncatula] Length = 809 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 561 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 596 >ref|XP_008243978.1| PREDICTED: cell division control protein 48 homolog D [Prunus mume] Length = 806 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 560 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 595 >ref|XP_007144357.1| hypothetical protein PHAVU_007G149400g [Phaseolus vulgaris] gi|561017547|gb|ESW16351.1| hypothetical protein PHAVU_007G149400g [Phaseolus vulgaris] Length = 811 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 560 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 595 >ref|XP_004497529.1| PREDICTED: cell division cycle protein 48 homolog [Cicer arietinum] Length = 808 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 560 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 595 >ref|XP_004493989.1| PREDICTED: cell division control protein 48 homolog D [Cicer arietinum] Length = 809 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 560 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 595 >gb|EMT26392.1| Cell division control 48-E-like protein [Aegilops tauschii] Length = 1207 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 586 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 621 >gb|EMS47029.1| Cell division cycle protein 48-like protein [Triticum urartu] Length = 818 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 569 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 604 >ref|XP_007211349.1| hypothetical protein PRUPE_ppa001545mg [Prunus persica] gi|462407214|gb|EMJ12548.1| hypothetical protein PRUPE_ppa001545mg [Prunus persica] Length = 804 Score = 72.0 bits (175), Expect = 3e-10 Identities = 34/36 (94%), Positives = 35/36 (97%) Frame = +2 Query: 548 EANVRETFDKARGSAPCVLFFDELDSVATQRGSSVG 655 EANVRE FDKARGSAPCVLFFDELDS+ATQRGSSVG Sbjct: 562 EANVREIFDKARGSAPCVLFFDELDSIATQRGSSVG 597