BLASTX nr result
ID: Papaver29_contig00023139
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00023139 (417 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KCW55427.1| hypothetical protein EUGRSUZ_I01330 [Eucalyptus g... 85 2e-14 >gb|KCW55427.1| hypothetical protein EUGRSUZ_I01330 [Eucalyptus grandis] Length = 121 Score = 85.1 bits (209), Expect = 2e-14 Identities = 42/58 (72%), Positives = 46/58 (79%) Frame = +3 Query: 138 SLKGRGQGVDVGTSTLSLILSICFSFFGLEFPKVPLNIFPFFVLLSPRPHSSGKDGFA 311 SLKGRGQGVD+GTSTLSL+ SI FSFFG FP PLN+FPFFV LSP PH +G G A Sbjct: 2 SLKGRGQGVDLGTSTLSLMRSIFFSFFGRAFPYDPLNLFPFFVRLSPLPHRTGSGGAA 59