BLASTX nr result
ID: Papaver29_contig00022985
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00022985 (910 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010269946.1| PREDICTED: two-component response regulator-... 46 3e-06 ref|XP_010269954.1| PREDICTED: two-component response regulator-... 46 3e-06 >ref|XP_010269946.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720044623|ref|XP_010269947.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720044626|ref|XP_010269948.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720044631|ref|XP_010269949.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720044634|ref|XP_010269950.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720044638|ref|XP_010269951.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] gi|720044641|ref|XP_010269952.1| PREDICTED: two-component response regulator-like APRR2 isoform X1 [Nelumbo nucifera] Length = 563 Score = 45.8 bits (107), Expect(2) = 3e-06 Identities = 22/38 (57%), Positives = 23/38 (60%) Frame = -2 Query: 909 GMHVDAWGCPVMPPSQNPNFTIPQMQNNASAGYQSLLD 796 GMH DAWGCPVMP Q P T PQ S G+QS D Sbjct: 463 GMHADAWGCPVMPMPQGPYSTFPQ----NSLGFQSFED 496 Score = 33.5 bits (75), Expect(2) = 3e-06 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = -3 Query: 722 STESVLFELQRQGISIIPP-QNPNT 651 STESVL EL RQGIS IPP +N N+ Sbjct: 537 STESVLSELHRQGISCIPPYKNTNS 561 >ref|XP_010269954.1| PREDICTED: two-component response regulator-like APRR2 isoform X3 [Nelumbo nucifera] Length = 554 Score = 45.8 bits (107), Expect(2) = 3e-06 Identities = 22/38 (57%), Positives = 23/38 (60%) Frame = -2 Query: 909 GMHVDAWGCPVMPPSQNPNFTIPQMQNNASAGYQSLLD 796 GMH DAWGCPVMP Q P T PQ S G+QS D Sbjct: 454 GMHADAWGCPVMPMPQGPYSTFPQ----NSLGFQSFED 487 Score = 33.5 bits (75), Expect(2) = 3e-06 Identities = 18/25 (72%), Positives = 20/25 (80%), Gaps = 1/25 (4%) Frame = -3 Query: 722 STESVLFELQRQGISIIPP-QNPNT 651 STESVL EL RQGIS IPP +N N+ Sbjct: 528 STESVLSELHRQGISCIPPYKNTNS 552