BLASTX nr result
ID: Papaver29_contig00019589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00019589 (448 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009779658.1| PREDICTED: exportin-T isoform X2 [Nicotiana ... 57 5e-06 ref|XP_009779656.1| PREDICTED: exportin-T isoform X1 [Nicotiana ... 57 5e-06 ref|XP_009607329.1| PREDICTED: exportin-T isoform X2 [Nicotiana ... 57 5e-06 ref|XP_009607327.1| PREDICTED: exportin-T isoform X1 [Nicotiana ... 57 5e-06 >ref|XP_009779658.1| PREDICTED: exportin-T isoform X2 [Nicotiana sylvestris] Length = 934 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 447 QVRKLLLNANVQNQEESYAKIANIQQLIMAINALSKG 337 QV LLLNA QN EES AKIANIQQ+IMAINALSKG Sbjct: 635 QVEALLLNAKAQNPEESPAKIANIQQIIMAINALSKG 671 >ref|XP_009779656.1| PREDICTED: exportin-T isoform X1 [Nicotiana sylvestris] gi|698589161|ref|XP_009779657.1| PREDICTED: exportin-T isoform X1 [Nicotiana sylvestris] Length = 989 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 447 QVRKLLLNANVQNQEESYAKIANIQQLIMAINALSKG 337 QV LLLNA QN EES AKIANIQQ+IMAINALSKG Sbjct: 635 QVEALLLNAKAQNPEESPAKIANIQQIIMAINALSKG 671 >ref|XP_009607329.1| PREDICTED: exportin-T isoform X2 [Nicotiana tomentosiformis] Length = 934 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 447 QVRKLLLNANVQNQEESYAKIANIQQLIMAINALSKG 337 QV LLLNA QN EES AKIANIQQ+IMAINALSKG Sbjct: 635 QVEALLLNAKAQNPEESPAKIANIQQIIMAINALSKG 671 >ref|XP_009607327.1| PREDICTED: exportin-T isoform X1 [Nicotiana tomentosiformis] gi|697106996|ref|XP_009607328.1| PREDICTED: exportin-T isoform X1 [Nicotiana tomentosiformis] Length = 989 Score = 57.0 bits (136), Expect = 5e-06 Identities = 30/37 (81%), Positives = 31/37 (83%) Frame = -2 Query: 447 QVRKLLLNANVQNQEESYAKIANIQQLIMAINALSKG 337 QV LLLNA QN EES AKIANIQQ+IMAINALSKG Sbjct: 635 QVEALLLNAKAQNPEESPAKIANIQQIIMAINALSKG 671