BLASTX nr result
ID: Papaver29_contig00018880
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00018880 (376 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010244365.1| PREDICTED: transcription factor bHLH87 [Nelu... 57 7e-06 >ref|XP_010244365.1| PREDICTED: transcription factor bHLH87 [Nelumbo nucifera] Length = 454 Score = 56.6 bits (135), Expect = 7e-06 Identities = 29/50 (58%), Positives = 35/50 (70%) Frame = -1 Query: 376 NYLKFLKSQVKALETIGQKLQSMNPTSLSTPQFDINSAFSMQTLFQFPKP 227 NYLKFL+SQVKALET+G K S+N +S + P N F MQT+F PKP Sbjct: 408 NYLKFLRSQVKALETLGHKADSVNCSSTNLPP---NLPFPMQTIFPLPKP 454