BLASTX nr result
ID: Papaver29_contig00015819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00015819 (966 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010267933.1| PREDICTED: FHA domain-containing protein At4... 66 4e-08 ref|XP_006489605.1| PREDICTED: FHA domain-containing protein At4... 65 6e-08 ref|XP_006489537.1| PREDICTED: FHA domain-containing protein At4... 65 6e-08 ref|XP_006420146.1| hypothetical protein CICLE_v10004978mg [Citr... 65 6e-08 ref|XP_009604884.1| PREDICTED: FHA domain-containing protein At4... 65 1e-07 ref|XP_013456939.1| FHA domain plant protein [Medicago truncatul... 64 2e-07 gb|KDO41743.1| hypothetical protein CISIN_1g031684mg [Citrus sin... 63 3e-07 ref|XP_009761141.1| PREDICTED: FHA domain-containing protein At4... 63 4e-07 ref|XP_011073504.1| PREDICTED: FHA domain-containing protein At4... 62 5e-07 ref|XP_003628922.2| FHA domain plant protein [Medicago truncatul... 62 5e-07 ref|XP_012481948.1| PREDICTED: FHA domain-containing protein At4... 62 7e-07 ref|XP_010650014.1| PREDICTED: FHA domain-containing protein At4... 62 9e-07 gb|KHG13531.1| hypothetical protein F383_04481 [Gossypium arboreum] 62 9e-07 ref|XP_004505100.1| PREDICTED: FHA domain-containing protein At4... 62 9e-07 ref|XP_010094272.1| FHA domain-containing protein [Morus notabil... 61 2e-06 ref|XP_013456940.1| FHA domain plant protein [Medicago truncatul... 60 2e-06 ref|XP_003602349.1| FHA domain plant protein [Medicago truncatul... 60 2e-06 ref|XP_006355426.1| PREDICTED: FHA domain-containing protein At4... 59 4e-06 ref|XP_004246158.1| PREDICTED: FHA domain-containing protein At4... 59 4e-06 emb|CDX91990.1| BnaC03g32920D [Brassica napus] 59 6e-06 >ref|XP_010267933.1| PREDICTED: FHA domain-containing protein At4g14490-like [Nelumbo nucifera] gi|720038260|ref|XP_010267934.1| PREDICTED: FHA domain-containing protein At4g14490-like [Nelumbo nucifera] Length = 456 Score = 66.2 bits (160), Expect = 4e-08 Identities = 33/57 (57%), Positives = 42/57 (73%), Gaps = 1/57 (1%) Frame = -1 Query: 468 ASTSDGGVRENLVEENKV-DFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERSR 301 AS+S REN ++ + + EKMTLGEWFDY+EVYLPKQI TEEI+ SMRE ++ Sbjct: 382 ASSSTTAARENSIKVVDIKELEKMTLGEWFDYLEVYLPKQIYDITEEIILSMRESAK 438 >ref|XP_006489605.1| PREDICTED: FHA domain-containing protein At4g14490-like [Citrus sinensis] Length = 332 Score = 65.5 bits (158), Expect = 6e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 441 ENLVEENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 +N V+E KVD KMTLGEWFDYMEVYL KQI TTEE++ M+ ++ Sbjct: 268 DNGVQEQKVDLAKMTLGEWFDYMEVYLRKQILNTTEEMIEEMKSKA 313 >ref|XP_006489537.1| PREDICTED: FHA domain-containing protein At4g14490-like [Citrus sinensis] Length = 498 Score = 65.5 bits (158), Expect = 6e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 441 ENLVEENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 +N V+E KVD KMTLGEWFDYMEVYL KQI TTEE++ M+ ++ Sbjct: 434 DNGVQEQKVDLAKMTLGEWFDYMEVYLRKQILNTTEEMIEEMKSKA 479 >ref|XP_006420146.1| hypothetical protein CICLE_v10004978mg [Citrus clementina] gi|557522019|gb|ESR33386.1| hypothetical protein CICLE_v10004978mg [Citrus clementina] Length = 441 Score = 65.5 bits (158), Expect = 6e-08 Identities = 29/46 (63%), Positives = 36/46 (78%) Frame = -1 Query: 441 ENLVEENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 +N V+E KVD KMTLGEWFDYMEVYL KQI TTEE++ M+ ++ Sbjct: 377 DNGVQEQKVDLAKMTLGEWFDYMEVYLRKQILNTTEEMIEEMKSKA 422 >ref|XP_009604884.1| PREDICTED: FHA domain-containing protein At4g14490-like [Nicotiana tomentosiformis] Length = 537 Score = 64.7 bits (156), Expect = 1e-07 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 465 STSDGGVRENLVEENK-VDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 S S+ GV + V+E K VD EKMTLGEWFDY+EV+LPKQI TEE++ M++++ Sbjct: 461 SVSNAGVSMSEVQEEKEVDLEKMTLGEWFDYLEVHLPKQIIDATEEMILDMKQKA 515 >ref|XP_013456939.1| FHA domain plant protein [Medicago truncatula] gi|657389254|gb|KEH30970.1| FHA domain plant protein [Medicago truncatula] Length = 515 Score = 63.5 bits (153), Expect = 2e-07 Identities = 30/52 (57%), Positives = 39/52 (75%), Gaps = 1/52 (1%) Frame = -1 Query: 456 DGGVRENLV-EENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 D +ENL +EN D EKM LGEWFD++EVYLPKQI TEEI+ SM++++ Sbjct: 443 DAKEKENLNGDENWPDLEKMNLGEWFDFLEVYLPKQIHDETEEIIDSMKQKA 494 >gb|KDO41743.1| hypothetical protein CISIN_1g031684mg [Citrus sinensis] Length = 155 Score = 63.2 bits (152), Expect = 3e-07 Identities = 27/46 (58%), Positives = 36/46 (78%) Frame = -1 Query: 441 ENLVEENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 +N V+E KVD KMTLGEWFDY+EVY+ KQI TTEE++ M+ ++ Sbjct: 91 DNGVQEQKVDLAKMTLGEWFDYVEVYMRKQILNTTEEMIEEMKNKA 136 >ref|XP_009761141.1| PREDICTED: FHA domain-containing protein At4g14490-like [Nicotiana sylvestris] gi|698528617|ref|XP_009761142.1| PREDICTED: FHA domain-containing protein At4g14490-like [Nicotiana sylvestris] Length = 541 Score = 62.8 bits (151), Expect = 4e-07 Identities = 30/55 (54%), Positives = 42/55 (76%), Gaps = 1/55 (1%) Frame = -1 Query: 465 STSDGGVRENLVEENK-VDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 S ++ GV + V+E K VD EKMTLGEWFDY+EV+LPKQI TEE++ M++++ Sbjct: 465 SVNNTGVSMSEVQEEKEVDLEKMTLGEWFDYLEVHLPKQIIDATEEMILDMKQKT 519 >ref|XP_011073504.1| PREDICTED: FHA domain-containing protein At4g14490 [Sesamum indicum] Length = 466 Score = 62.4 bits (150), Expect = 5e-07 Identities = 33/59 (55%), Positives = 43/59 (72%), Gaps = 4/59 (6%) Frame = -1 Query: 468 ASTSDGGVRENLVEENK----VDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 ASTS GV+E + K VD EKMTLGEWFD++EV+LPKQI TEE++S MR+++ Sbjct: 388 ASTS--GVKEGGADVGKGKAVVDLEKMTLGEWFDFLEVFLPKQIIDETEEMISEMRQKA 444 >ref|XP_003628922.2| FHA domain plant protein [Medicago truncatula] gi|657374613|gb|AET03398.2| FHA domain plant protein [Medicago truncatula] Length = 515 Score = 62.4 bits (150), Expect = 5e-07 Identities = 30/52 (57%), Positives = 38/52 (73%), Gaps = 1/52 (1%) Frame = -1 Query: 456 DGGVRENLV-EENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 D +ENL +EN D EKM LGEWFD++EVYLPKQI TEEI+ SM +++ Sbjct: 443 DAKEKENLNGDENWPDLEKMNLGEWFDFLEVYLPKQIHDETEEIIDSMTQKA 494 >ref|XP_012481948.1| PREDICTED: FHA domain-containing protein At4g14490-like [Gossypium raimondii] gi|763761170|gb|KJB28424.1| hypothetical protein B456_005G047200 [Gossypium raimondii] Length = 330 Score = 62.0 bits (149), Expect = 7e-07 Identities = 27/49 (55%), Positives = 39/49 (79%) Frame = -1 Query: 447 VRENLVEENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERSR 301 VRE+ E +VD EKMTL +WFDY+EV+LPKQI + TEE++ MR++++ Sbjct: 264 VRESCDERVEVDLEKMTLRQWFDYLEVHLPKQILEATEEMIEGMRKKAQ 312 >ref|XP_010650014.1| PREDICTED: FHA domain-containing protein At4g14490-like [Vitis vinifera] Length = 388 Score = 61.6 bits (148), Expect = 9e-07 Identities = 31/55 (56%), Positives = 39/55 (70%), Gaps = 1/55 (1%) Frame = -1 Query: 468 ASTSDGGVRENLVEENK-VDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRER 307 ASTS G +E E D EKMTLG+WFDY+E++LPKQI TEE+++ MRER Sbjct: 313 ASTSMSGAKEWPTEVGDGPDLEKMTLGDWFDYLELHLPKQIYDVTEEMIAGMRER 367 >gb|KHG13531.1| hypothetical protein F383_04481 [Gossypium arboreum] Length = 353 Score = 61.6 bits (148), Expect = 9e-07 Identities = 27/48 (56%), Positives = 38/48 (79%) Frame = -1 Query: 447 VRENLVEENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 VRE+ E +VD EKMTL +WFDY+EV+LPKQI + TEE++ MR+++ Sbjct: 264 VRESCDERVEVDLEKMTLRQWFDYLEVHLPKQILEATEEMIEDMRKKA 311 >ref|XP_004505100.1| PREDICTED: FHA domain-containing protein At4g14490-like [Cicer arietinum] Length = 429 Score = 61.6 bits (148), Expect = 9e-07 Identities = 32/61 (52%), Positives = 40/61 (65%), Gaps = 7/61 (11%) Frame = -1 Query: 465 STSDGGVRENL-------VEENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRER 307 S DG +ENL EN D EKMTL EWFD++EVYLPKQI TEE+ +SMR++ Sbjct: 348 SCDDGKEKENLNLNVDRNENENWPDLEKMTLAEWFDFLEVYLPKQIIDETEEMFASMRQK 407 Query: 306 S 304 + Sbjct: 408 A 408 >ref|XP_010094272.1| FHA domain-containing protein [Morus notabilis] gi|587866046|gb|EXB55546.1| FHA domain-containing protein [Morus notabilis] Length = 455 Score = 60.8 bits (146), Expect = 2e-06 Identities = 30/54 (55%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -1 Query: 459 SDGGVRENLVEENK-VDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERSR 301 S G +EN E K VD EKMTLGEWFD++EV LPKQI + TEE++ MR +++ Sbjct: 383 SGSGSKENSFEVGKGVDLEKMTLGEWFDFLEVTLPKQIIEATEEMIMGMRLKAK 436 >ref|XP_013456940.1| FHA domain plant protein [Medicago truncatula] gi|657389255|gb|KEH30971.1| FHA domain plant protein [Medicago truncatula] Length = 278 Score = 60.5 bits (145), Expect = 2e-06 Identities = 25/40 (62%), Positives = 33/40 (82%) Frame = -1 Query: 423 NKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 N D EKM+LGEWFD++EVYLPKQI TE+I+ SMR+++ Sbjct: 217 NMPDLEKMSLGEWFDFLEVYLPKQIHDETEDIIDSMRQKA 256 >ref|XP_003602349.1| FHA domain plant protein [Medicago truncatula] gi|355491397|gb|AES72600.1| FHA domain plant protein [Medicago truncatula] Length = 433 Score = 60.5 bits (145), Expect = 2e-06 Identities = 28/52 (53%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = -1 Query: 456 DGGVRENLV-EENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 D +ENL+ +EN D EK++LGEWFD++EV LPKQI T+EI+ SMR+++ Sbjct: 361 DVNEKENLIGDENWPDLEKISLGEWFDFLEVCLPKQIHDETKEIIDSMRQKA 412 >ref|XP_006355426.1| PREDICTED: FHA domain-containing protein At4g14490-like [Solanum tuberosum] Length = 504 Score = 59.3 bits (142), Expect = 4e-06 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -1 Query: 426 ENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 E +VD EKMTLGEW DY+E+YLPKQI TEE++ M++++ Sbjct: 442 EEEVDLEKMTLGEWLDYLEIYLPKQIIDATEEMILGMKQKT 482 >ref|XP_004246158.1| PREDICTED: FHA domain-containing protein At4g14490-like [Solanum lycopersicum] gi|723725091|ref|XP_010325492.1| PREDICTED: FHA domain-containing protein At4g14490-like [Solanum lycopersicum] Length = 504 Score = 59.3 bits (142), Expect = 4e-06 Identities = 24/41 (58%), Positives = 33/41 (80%) Frame = -1 Query: 426 ENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMRERS 304 E +VD EKMTLGEW DY+E+YLPKQI TEE++ M++++ Sbjct: 442 EEEVDLEKMTLGEWLDYLEIYLPKQIIDATEEMILGMKQKA 482 >emb|CDX91990.1| BnaC03g32920D [Brassica napus] Length = 837 Score = 58.9 bits (141), Expect = 6e-06 Identities = 32/64 (50%), Positives = 41/64 (64%), Gaps = 10/64 (15%) Frame = -1 Query: 462 TSDGGVRE----------NLVEENKVDFEKMTLGEWFDYMEVYLPKQIRKTTEEIVSSMR 313 TSDG E N+VE KVD EKMTLG+WF+YM+VY+ K+I TEE++ MR Sbjct: 386 TSDGECEEEEEKAEQESRNVVE--KVDLEKMTLGDWFEYMKVYMRKKIMDETEEMIEGMR 443 Query: 312 ERSR 301 +SR Sbjct: 444 AKSR 447