BLASTX nr result
ID: Papaver29_contig00015618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00015618 (405 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20802.3| unnamed protein product [Vitis vinifera] 85 4e-16 ref|XP_002283203.1| PREDICTED: cation transport regulator-like p... 85 4e-16 ref|XP_013650189.1| PREDICTED: putative glutathione-specific gam... 84 8e-16 ref|XP_010447591.1| PREDICTED: cation transport regulator-like p... 84 1e-15 ref|XP_010438057.1| PREDICTED: cation transport regulator-like p... 84 1e-15 ref|XP_006284480.1| hypothetical protein CARUB_v10005666mg [Caps... 84 1e-15 ref|XP_013636985.1| PREDICTED: putative glutathione-specific gam... 84 1e-15 ref|XP_009127116.1| PREDICTED: cation transport regulator-like p... 84 1e-15 gb|AFK43603.1| unknown [Lotus japonicus] 84 1e-15 emb|CDX68731.1| BnaC01g07220D [Brassica napus] 84 2e-15 emb|CAA16532.1| predicted protein [Arabidopsis thaliana] gi|7270... 82 3e-15 ref|XP_010432881.1| PREDICTED: cation transport regulator-like p... 82 3e-15 ref|XP_006412611.1| hypothetical protein EUTSA_v10026164mg [Eutr... 82 3e-15 ref|XP_002869338.1| hypothetical protein ARALYDRAFT_491614 [Arab... 82 3e-15 ref|NP_567871.1| chaC-like protein [Arabidopsis thaliana] gi|301... 82 3e-15 gb|AAM65482.1| unknown [Arabidopsis thaliana] 82 3e-15 ref|XP_009801053.1| PREDICTED: cation transport regulator-like p... 84 3e-15 ref|XP_009593977.1| PREDICTED: cation transport regulator-like p... 84 3e-15 ref|XP_008782810.1| PREDICTED: cation transport regulator-like p... 82 3e-15 ref|XP_006412612.1| hypothetical protein EUTSA_v10026164mg [Eutr... 82 3e-15 >emb|CBI20802.3| unnamed protein product [Vitis vinifera] Length = 264 Score = 84.7 bits (208), Expect(2) = 4e-16 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 284 HKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 +KRVFDLACIDHRGTPEHPARTCTLE EG ICWGAAFCV Sbjct: 72 YKRVFDLACIDHRGTPEHPARTCTLEQSEGAICWGAAFCV 111 Score = 26.6 bits (57), Expect(2) = 4e-16 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MVLWVFGYGS Sbjct: 43 MVLWVFGYGS 52 >ref|XP_002283203.1| PREDICTED: cation transport regulator-like protein 2 [Vitis vinifera] Length = 222 Score = 84.7 bits (208), Expect(2) = 4e-16 Identities = 36/40 (90%), Positives = 37/40 (92%) Frame = +2 Query: 284 HKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 +KRVFDLACIDHRGTPEHPARTCTLE EG ICWGAAFCV Sbjct: 30 YKRVFDLACIDHRGTPEHPARTCTLEQSEGAICWGAAFCV 69 Score = 26.6 bits (57), Expect(2) = 4e-16 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MVLWVFGYGS Sbjct: 1 MVLWVFGYGS 10 >ref|XP_013650189.1| PREDICTED: putative glutathione-specific gamma-glutamylcyclotransferase 2 [Brassica napus] gi|674904859|emb|CDY28253.1| BnaA01g05960D [Brassica napus] Length = 228 Score = 84.3 bits (207), Expect(2) = 8e-16 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWGAAFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKHEEAICWGAAFCV 69 Score = 25.8 bits (55), Expect(2) = 8e-16 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10 >ref|XP_010447591.1| PREDICTED: cation transport regulator-like protein 2 [Camelina sativa] Length = 227 Score = 84.0 bits (206), Expect(2) = 1e-15 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWGAAFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKAEEAICWGAAFCV 69 Score = 25.8 bits (55), Expect(2) = 1e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10 >ref|XP_010438057.1| PREDICTED: cation transport regulator-like protein 2 [Camelina sativa] Length = 227 Score = 84.0 bits (206), Expect(2) = 1e-15 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWGAAFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKAEEAICWGAAFCV 69 Score = 25.8 bits (55), Expect(2) = 1e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10 >ref|XP_006284480.1| hypothetical protein CARUB_v10005666mg [Capsella rubella] gi|482553185|gb|EOA17378.1| hypothetical protein CARUB_v10005666mg [Capsella rubella] Length = 227 Score = 84.0 bits (206), Expect(2) = 1e-15 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWGAAFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKAEEAICWGAAFCV 69 Score = 25.8 bits (55), Expect(2) = 1e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10 >ref|XP_013636985.1| PREDICTED: putative glutathione-specific gamma-glutamylcyclotransferase 2 [Brassica oleracea var. oleracea] gi|923739517|ref|XP_013670791.1| PREDICTED: putative glutathione-specific gamma-glutamylcyclotransferase 2 [Brassica napus] Length = 227 Score = 83.6 bits (205), Expect(2) = 1e-15 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWGAAFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKDEEAICWGAAFCV 69 Score = 25.8 bits (55), Expect(2) = 1e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10 >ref|XP_009127116.1| PREDICTED: cation transport regulator-like protein 2 [Brassica rapa] Length = 227 Score = 83.6 bits (205), Expect(2) = 1e-15 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWGAAFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKDEEAICWGAAFCV 69 Score = 25.8 bits (55), Expect(2) = 1e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10 >gb|AFK43603.1| unknown [Lotus japonicus] Length = 224 Score = 84.3 bits (207), Expect(2) = 1e-15 Identities = 34/40 (85%), Positives = 38/40 (95%) Frame = +2 Query: 284 HKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 ++RVFDLACIDHRGTPEHPARTCTLE +EGEICWGA +CV Sbjct: 30 YRRVFDLACIDHRGTPEHPARTCTLEEKEGEICWGAVYCV 69 Score = 25.0 bits (53), Expect(2) = 1e-15 Identities = 9/10 (90%), Positives = 9/10 (90%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV WVFGYGS Sbjct: 1 MVFWVFGYGS 10 >emb|CDX68731.1| BnaC01g07220D [Brassica napus] Length = 227 Score = 83.6 bits (205), Expect(2) = 2e-15 Identities = 36/41 (87%), Positives = 37/41 (90%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWGAAFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKDEEAICWGAAFCV 69 Score = 25.4 bits (54), Expect(2) = 2e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVVWVFGYGS 10 >emb|CAA16532.1| predicted protein [Arabidopsis thaliana] gi|7270031|emb|CAB79847.1| predicted protein [Arabidopsis thaliana] Length = 250 Score = 82.4 bits (202), Expect(2) = 3e-15 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWG AFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKAEEAICWGTAFCV 69 Score = 25.8 bits (55), Expect(2) = 3e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10 >ref|XP_010432881.1| PREDICTED: cation transport regulator-like protein 2 [Camelina sativa] gi|727513138|ref|XP_010432882.1| PREDICTED: cation transport regulator-like protein 2 [Camelina sativa] Length = 229 Score = 82.4 bits (202), Expect(2) = 3e-15 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWG AFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKAEEAICWGTAFCV 69 Score = 25.8 bits (55), Expect(2) = 3e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10 >ref|XP_006412611.1| hypothetical protein EUTSA_v10026164mg [Eutrema salsugineum] gi|557113781|gb|ESQ54064.1| hypothetical protein EUTSA_v10026164mg [Eutrema salsugineum] Length = 227 Score = 82.4 bits (202), Expect(2) = 3e-15 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWG AFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKAEEAICWGTAFCV 69 Score = 25.8 bits (55), Expect(2) = 3e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10 >ref|XP_002869338.1| hypothetical protein ARALYDRAFT_491614 [Arabidopsis lyrata subsp. lyrata] gi|297315174|gb|EFH45597.1| hypothetical protein ARALYDRAFT_491614 [Arabidopsis lyrata subsp. lyrata] Length = 227 Score = 82.4 bits (202), Expect(2) = 3e-15 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWG AFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKAEEAICWGTAFCV 69 Score = 25.8 bits (55), Expect(2) = 3e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10 >ref|NP_567871.1| chaC-like protein [Arabidopsis thaliana] gi|30102602|gb|AAP21219.1| At4g31290 [Arabidopsis thaliana] gi|110743783|dbj|BAE99727.1| hypothetical protein [Arabidopsis thaliana] gi|332660486|gb|AEE85886.1| chaC-like protein [Arabidopsis thaliana] Length = 227 Score = 82.4 bits (202), Expect(2) = 3e-15 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWG AFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKAEEAICWGTAFCV 69 Score = 25.8 bits (55), Expect(2) = 3e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10 >gb|AAM65482.1| unknown [Arabidopsis thaliana] Length = 227 Score = 82.4 bits (202), Expect(2) = 3e-15 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWG AFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKAEEAICWGTAFCV 69 Score = 25.8 bits (55), Expect(2) = 3e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10 >ref|XP_009801053.1| PREDICTED: cation transport regulator-like protein 2 [Nicotiana sylvestris] Length = 226 Score = 83.6 bits (205), Expect(2) = 3e-15 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +2 Query: 284 HKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 +KRVFDLACIDHRGTPEHPARTCTLE EG ICWGAA+CV Sbjct: 30 YKRVFDLACIDHRGTPEHPARTCTLEESEGAICWGAAYCV 69 Score = 24.6 bits (52), Expect(2) = 3e-15 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV W+FGYGS Sbjct: 1 MVFWIFGYGS 10 >ref|XP_009593977.1| PREDICTED: cation transport regulator-like protein 2 [Nicotiana tomentosiformis] Length = 226 Score = 83.6 bits (205), Expect(2) = 3e-15 Identities = 35/40 (87%), Positives = 37/40 (92%) Frame = +2 Query: 284 HKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 +KRVFDLACIDHRGTPEHPARTCTLE EG ICWGAA+CV Sbjct: 30 YKRVFDLACIDHRGTPEHPARTCTLEESEGAICWGAAYCV 69 Score = 24.6 bits (52), Expect(2) = 3e-15 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV W+FGYGS Sbjct: 1 MVFWIFGYGS 10 >ref|XP_008782810.1| PREDICTED: cation transport regulator-like protein 2 [Phoenix dactylifera] Length = 209 Score = 81.6 bits (200), Expect(2) = 3e-15 Identities = 31/40 (77%), Positives = 39/40 (97%) Frame = +2 Query: 284 HKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 ++RVFDLACIDHRGTPE+PARTCTLEA++GE+CWG A+C+ Sbjct: 30 YRRVFDLACIDHRGTPENPARTCTLEAKQGEVCWGTAYCI 69 Score = 26.6 bits (57), Expect(2) = 3e-15 Identities = 10/10 (100%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MVLWVFGYGS Sbjct: 1 MVLWVFGYGS 10 >ref|XP_006412612.1| hypothetical protein EUTSA_v10026164mg [Eutrema salsugineum] gi|557113782|gb|ESQ54065.1| hypothetical protein EUTSA_v10026164mg [Eutrema salsugineum] Length = 165 Score = 82.4 bits (202), Expect(2) = 3e-15 Identities = 35/41 (85%), Positives = 36/41 (87%) Frame = +2 Query: 281 GHKRVFDLACIDHRGTPEHPARTCTLEAREGEICWGAAFCV 403 G+KRVFDLACIDHRGTPEHPARTCTLE E ICWG AFCV Sbjct: 29 GYKRVFDLACIDHRGTPEHPARTCTLEKAEEAICWGTAFCV 69 Score = 25.8 bits (55), Expect(2) = 3e-15 Identities = 9/10 (90%), Positives = 10/10 (100%) Frame = +1 Query: 247 MVLWVFGYGS 276 MV+WVFGYGS Sbjct: 1 MVMWVFGYGS 10