BLASTX nr result
ID: Papaver29_contig00014402
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00014402 (606 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012084768.1| PREDICTED: pentatricopeptide repeat-containi... 122 2e-25 ref|XP_010258197.1| PREDICTED: pentatricopeptide repeat-containi... 117 5e-24 ref|XP_007032641.1| Pentatricopeptide repeat-containing protein,... 115 2e-23 ref|XP_008787087.1| PREDICTED: pentatricopeptide repeat-containi... 115 2e-23 ref|XP_010936388.1| PREDICTED: pentatricopeptide repeat-containi... 112 1e-22 ref|XP_009411084.1| PREDICTED: pentatricopeptide repeat-containi... 110 8e-22 ref|XP_007217161.1| hypothetical protein PRUPE_ppa001868mg [Prun... 108 2e-21 ref|XP_012460938.1| PREDICTED: pentatricopeptide repeat-containi... 107 4e-21 ref|XP_008230994.1| PREDICTED: LOW QUALITY PROTEIN: pentatricope... 105 2e-20 ref|XP_011098691.1| PREDICTED: pentatricopeptide repeat-containi... 104 4e-20 ref|XP_007207048.1| hypothetical protein PRUPE_ppb025182mg [Prun... 101 3e-19 ref|XP_014506941.1| PREDICTED: pentatricopeptide repeat-containi... 101 4e-19 gb|KRH09491.1| hypothetical protein GLYMA_16G218400 [Glycine max] 100 5e-19 gb|KHN24542.1| Pentatricopeptide repeat-containing protein [Glyc... 100 5e-19 ref|XP_009365834.1| PREDICTED: putative pentatricopeptide repeat... 100 5e-19 ref|XP_006848707.1| PREDICTED: pentatricopeptide repeat-containi... 100 5e-19 ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containi... 100 5e-19 gb|KOM33368.1| hypothetical protein LR48_Vigan01g292400 [Vigna a... 100 6e-19 ref|XP_014512078.1| PREDICTED: pentatricopeptide repeat-containi... 100 8e-19 gb|KOM54550.1| hypothetical protein LR48_Vigan10g044200 [Vigna a... 100 8e-19 >ref|XP_012084768.1| PREDICTED: pentatricopeptide repeat-containing protein At1g06140, mitochondrial-like [Jatropha curcas] gi|643714841|gb|KDP27196.1| hypothetical protein JCGZ_19895 [Jatropha curcas] Length = 782 Score = 122 bits (305), Expect = 2e-25 Identities = 55/97 (56%), Positives = 75/97 (77%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 SR+GQLEEAYGLV+ LP R+R+ AL ALL++C+VY N E+G+++G+ LL+L P N+ YT Sbjct: 679 SRAGQLEEAYGLVKFLPSRQRAQALGALLAACQVYGNTEMGEVIGKHLLDLEPENASAYT 738 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIE 316 L+ NLYAE+GKWD ++R + K K L R GYS+IE Sbjct: 739 LMSNLYAESGKWDDVVKIRSMTKEKGLRRIHGYSLIE 775 >ref|XP_010258197.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Nelumbo nucifera] Length = 792 Score = 117 bits (293), Expect = 5e-24 Identities = 54/96 (56%), Positives = 73/96 (76%) Frame = -1 Query: 603 RSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYTL 424 R+G L EAY LV++LP + +SAL +LLS+CRVYKN E+G+ +GR+LL+L P N G YTL Sbjct: 697 RAGHLVEAYDLVKYLPSGQSASALKSLLSACRVYKNFEMGEAIGRQLLDLEPENPGAYTL 756 Query: 423 LGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIE 316 + N++AEAGKWD AR+R IA K L + GYS++E Sbjct: 757 VSNIFAEAGKWDEVARIRAIANEKGLKKITGYSVLE 792 >ref|XP_007032641.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] gi|508711670|gb|EOY03567.1| Pentatricopeptide repeat-containing protein, putative [Theobroma cacao] Length = 790 Score = 115 bits (288), Expect = 2e-23 Identities = 53/99 (53%), Positives = 76/99 (76%) Frame = -1 Query: 603 RSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYTL 424 R+G+LE AY LV+ LP R+ ++AL ALL++CR++ N E+G+++G LL+L P+N Y L Sbjct: 690 RAGRLEVAYDLVRLLPERQSATALSALLAACRMHWNTEMGEVIGNRLLDLEPDNPSVYNL 749 Query: 423 LGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIESGS 307 + NLYAE+GKWDAAAR+R +AK + L + PGYS+IE S Sbjct: 750 VSNLYAESGKWDAAARMRNMAKKRGLKKPPGYSLIELDS 788 >ref|XP_008787087.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Phoenix dactylifera] Length = 802 Score = 115 bits (287), Expect = 2e-23 Identities = 51/96 (53%), Positives = 76/96 (79%) Frame = -1 Query: 603 RSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYTL 424 R+GQLEEAY V+ P R+++SAL ALL++CR+++N ++G+++G +LL+L P NSGTY L Sbjct: 699 RAGQLEEAYNFVKCSPLRDKASALCALLAACRIHRNTKLGEVIGSQLLDLEPTNSGTYAL 758 Query: 423 LGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIE 316 + N+YA+AGKW AA +R IA+ + L + PGYS+IE Sbjct: 759 VSNVYAQAGKWSEAANLRTIARERGLRKIPGYSLIE 794 >ref|XP_010936388.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Elaeis guineensis] Length = 796 Score = 112 bits (281), Expect = 1e-22 Identities = 51/96 (53%), Positives = 75/96 (78%) Frame = -1 Query: 603 RSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYTL 424 R+GQLEEAY V+ P R+++SA ALL++CR+++N ++G+++G LL+L P NSGTY+L Sbjct: 699 RAGQLEEAYNFVKCSPLRDKASAWCALLAACRIHRNTKLGEVIGSHLLDLEPMNSGTYSL 758 Query: 423 LGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIE 316 + N+YA+AGKW AA +R IA+ K L + PGYS+IE Sbjct: 759 VSNVYAQAGKWSEAANLRTIAREKGLRKIPGYSLIE 794 >ref|XP_009411084.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Musa acuminata subsp. malaccensis] gi|695046505|ref|XP_009411085.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Musa acuminata subsp. malaccensis] gi|695046507|ref|XP_009411086.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Musa acuminata subsp. malaccensis] gi|695046509|ref|XP_009411088.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Musa acuminata subsp. malaccensis] Length = 811 Score = 110 bits (274), Expect = 8e-22 Identities = 49/96 (51%), Positives = 76/96 (79%) Frame = -1 Query: 603 RSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYTL 424 R+GQLEEAY LV+ P R+R+SA+ LL++C+V+KN ++G+++G+ELL+L P SGTY L Sbjct: 708 RAGQLEEAYNLVKCSPLRDRASAMCTLLAACKVHKNTKLGELIGQELLDLEPQVSGTYAL 767 Query: 423 LGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIE 316 + N+YA++G W+ AA+V A+ + LA+ PGYS++E Sbjct: 768 MSNVYAQSGNWNEAAKVWTTARQRGLAKIPGYSLVE 803 >ref|XP_007217161.1| hypothetical protein PRUPE_ppa001868mg [Prunus persica] gi|462413311|gb|EMJ18360.1| hypothetical protein PRUPE_ppa001868mg [Prunus persica] Length = 751 Score = 108 bits (271), Expect = 2e-21 Identities = 51/97 (52%), Positives = 70/97 (72%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 SR+G LEEAY LV+ LP +S + LL++C+V+ N E+G+I+GR LL+L+P NS + Sbjct: 652 SRAGLLEEAYNLVKSLPSGLTASTVRTLLAACKVHGNTEIGEILGRRLLDLDPENSSVFA 711 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIE 316 ++ NLYAE GKW ARVR+ AK + L R PGYS+IE Sbjct: 712 MVSNLYAEGGKWGEVARVRDAAKQRGLKRTPGYSLIE 748 >ref|XP_012460938.1| PREDICTED: pentatricopeptide repeat-containing protein At2g03380, mitochondrial-like [Gossypium raimondii] gi|763808764|gb|KJB75666.1| hypothetical protein B456_012G050900 [Gossypium raimondii] Length = 793 Score = 107 bits (268), Expect = 4e-21 Identities = 49/97 (50%), Positives = 71/97 (73%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 SR+G+LEEAY L++ LP R+ +SA+ A+L++CR++ N E+G+++G LL+L P Y Sbjct: 689 SRAGRLEEAYELLKLLPARQSASAMAAMLAACRIHGNTELGEVIGHWLLDLEPERPSVYN 748 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIE 316 L+ NLYAE+GKWD AAR R +AK + L + GYS IE Sbjct: 749 LVSNLYAESGKWDEAARTRNMAKMRGLKKAAGYSQIE 785 >ref|XP_008230994.1| PREDICTED: LOW QUALITY PROTEIN: pentatricopeptide repeat-containing protein At3g03580-like [Prunus mume] Length = 780 Score = 105 bits (261), Expect = 2e-20 Identities = 49/97 (50%), Positives = 69/97 (71%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 SR+G LEEAY LV+ LP +S + LL++C+V+ N ++G+I+GR LL+L+P NS + Sbjct: 681 SRAGLLEEAYNLVKSLPSGLTASTVRTLLAACKVHGNTKMGEILGRRLLDLDPENSSVFA 740 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIE 316 ++ NLYAE GKW RVR+ AK + L R PGYS+IE Sbjct: 741 MVSNLYAEGGKWGEVVRVRDAAKQRGLKRTPGYSLIE 777 >ref|XP_011098691.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300-like [Sesamum indicum] Length = 793 Score = 104 bits (259), Expect = 4e-20 Identities = 46/97 (47%), Positives = 69/97 (71%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 SR+G++EEAY L++H+P R +SA+ ALL++CR++ N E+G+ VG+ LL++ P N+ Y Sbjct: 696 SRAGRVEEAYNLLKHVPSRRNASAIGALLAACRIHGNSEMGERVGQWLLDIEPQNASAYC 755 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIE 316 + N YA GKWD A + +AK K L R PGYS+I+ Sbjct: 756 SVSNFYAGEGKWDEVAHLGAVAKGKGLKRTPGYSLID 792 >ref|XP_007207048.1| hypothetical protein PRUPE_ppb025182mg [Prunus persica] gi|462402690|gb|EMJ08247.1| hypothetical protein PRUPE_ppb025182mg [Prunus persica] Length = 672 Score = 101 bits (252), Expect = 3e-19 Identities = 47/100 (47%), Positives = 68/100 (68%) Frame = -1 Query: 603 RSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYTL 424 R+GQLEEA L+ +P + ++ L ALL +CR++ N E+G+ VGR LL L P NSG Y L Sbjct: 449 RAGQLEEAEQLINSMPIKPNAAVLGALLGACRIHGNAEMGERVGRILLELEPQNSGRYAL 508 Query: 423 LGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIESGSV 304 L N+YA+AG+WD A +VR + K + + PG SM++ G + Sbjct: 509 LSNIYAKAGRWDDAEKVRMLMKERGVKTSPGISMVDIGGM 548 >ref|XP_014506941.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Vigna radiata var. radiata] Length = 590 Score = 101 bits (251), Expect = 4e-19 Identities = 44/101 (43%), Positives = 70/101 (69%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 +R+G+LEEA ++ +P ++ L ALL +CR++ N+E+G+ VG+ L+ L+P NSG Y Sbjct: 366 ARAGRLEEAKKVIDEMPMSPDAAVLGALLGACRIHGNLELGEEVGKRLIELDPGNSGRYV 425 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIESGSV 304 +LGN+YA GKWD A VR++ + + ++PG+SMIE V Sbjct: 426 ILGNIYASCGKWDEVAGVRKLMNDRGVKKEPGFSMIEMEGV 466 >gb|KRH09491.1| hypothetical protein GLYMA_16G218400 [Glycine max] Length = 601 Score = 100 bits (250), Expect = 5e-19 Identities = 47/99 (47%), Positives = 63/99 (63%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 SR G+LEEAY +++ +P + ALLSSCRV+ N+ +G+I +L L P N G Y Sbjct: 377 SRVGKLEEAYSIIKEMPFEPDACVWGALLSSCRVHNNLSLGEIAAEKLFFLEPTNPGNYI 436 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIESG 310 LL N+YA G WD R+RE+ K+K L + PGYS IE G Sbjct: 437 LLSNIYASKGLWDEENRIREVMKSKGLRKNPGYSWIEVG 475 >gb|KHN24542.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 598 Score = 100 bits (250), Expect = 5e-19 Identities = 47/99 (47%), Positives = 63/99 (63%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 SR G+LEEAY +++ +P + ALLSSCRV+ N+ +G+I +L L P N G Y Sbjct: 374 SRVGKLEEAYSIIKEMPFEPDACVWGALLSSCRVHNNLSLGEIAAEKLFFLEPTNPGNYI 433 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIESG 310 LL N+YA G WD R+RE+ K+K L + PGYS IE G Sbjct: 434 LLSNIYASKGLWDEENRIREVMKSKGLRKNPGYSWIEVG 472 >ref|XP_009365834.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g01580 [Pyrus x bretschneideri] Length = 786 Score = 100 bits (250), Expect = 5e-19 Identities = 45/98 (45%), Positives = 68/98 (69%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 SR+G LEEAY L++ +P +S L LL++C+V+ N E+G+++GR LL+L+P NS Sbjct: 689 SRAGLLEEAYDLIKSMPSDLTASPLKTLLAACKVHGNTEMGEVLGRRLLDLDPENSSAIA 748 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIES 313 L+ NLYAE GKW+ +R AK + L R PGYS++++ Sbjct: 749 LVSNLYAEGGKWNEVVGIRNTAKQRGLKRTPGYSLVQT 786 >ref|XP_006848707.1| PREDICTED: pentatricopeptide repeat-containing protein At4g21300 [Amborella trichopoda] gi|548852118|gb|ERN10288.1| hypothetical protein AMTR_s00177p00030400 [Amborella trichopoda] Length = 600 Score = 100 bits (250), Expect = 5e-19 Identities = 46/95 (48%), Positives = 71/95 (74%), Gaps = 1/95 (1%) Frame = -1 Query: 603 RSGQLEEAYGLVQHLPPRERS-SALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 R+G LEEAY ++ +P ++S S L ALL +CR++ N+++G++V +LL+L P NSGTYT Sbjct: 504 RAGHLEEAYSFIRSVPLLQKSTSTLGALLGACRIHGNVKMGEVVASQLLSLEPENSGTYT 563 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSM 322 LL N+YA+AG+W +A R+R A+ + L + PGYS+ Sbjct: 564 LLSNIYADAGQWRSAERLRTSARERGLKKIPGYSL 598 >ref|XP_003549191.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230-like isoform X1 [Glycine max] Length = 748 Score = 100 bits (250), Expect = 5e-19 Identities = 47/99 (47%), Positives = 63/99 (63%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 SR G+LEEAY +++ +P + ALLSSCRV+ N+ +G+I +L L P N G Y Sbjct: 524 SRVGKLEEAYSIIKEMPFEPDACVWGALLSSCRVHNNLSLGEIAAEKLFFLEPTNPGNYI 583 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIESG 310 LL N+YA G WD R+RE+ K+K L + PGYS IE G Sbjct: 584 LLSNIYASKGLWDEENRIREVMKSKGLRKNPGYSWIEVG 622 >gb|KOM33368.1| hypothetical protein LR48_Vigan01g292400 [Vigna angularis] Length = 605 Score = 100 bits (249), Expect = 6e-19 Identities = 44/101 (43%), Positives = 69/101 (68%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 +R+G+LEEA ++ +P ++ L ALL +CR++ N+E+G+ VG L+ L+P NSG Y Sbjct: 381 ARAGRLEEAKKVIDEMPMSPDAAVLGALLGACRIHGNLELGEEVGERLIELDPGNSGRYV 440 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIESGSV 304 +LGN+YA GKWD A VR++ + + ++PG+SMIE V Sbjct: 441 ILGNIYASCGKWDEVAGVRKLMNDRGVKKEPGFSMIEMEGV 481 >ref|XP_014512078.1| PREDICTED: pentatricopeptide repeat-containing protein At1g20230 [Vigna radiata var. radiata] Length = 748 Score = 100 bits (248), Expect = 8e-19 Identities = 47/99 (47%), Positives = 63/99 (63%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 SR G+LEEAY +++ +P + ALLSSCRV+ N+ +G+I +L L P N G Y Sbjct: 524 SRVGKLEEAYSIIKEMPFEPDACVWGALLSSCRVHNNLSLGEIAAEKLFPLEPANPGNYV 583 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIESG 310 LL N+YA G WD R+RE+ K+K L + PGYS IE G Sbjct: 584 LLSNIYASKGLWDEENRIREMMKSKGLRKNPGYSWIEVG 622 >gb|KOM54550.1| hypothetical protein LR48_Vigan10g044200 [Vigna angularis] Length = 675 Score = 100 bits (248), Expect = 8e-19 Identities = 47/99 (47%), Positives = 63/99 (63%) Frame = -1 Query: 606 SRSGQLEEAYGLVQHLPPRERSSALDALLSSCRVYKNMEVGDIVGRELLNLNPNNSGTYT 427 SR G+LEEAY +++ +P + ALLSSCRV+ N+ +G+I +L L P N G Y Sbjct: 524 SRVGKLEEAYSIIKEMPFEPDACVWGALLSSCRVHNNLSLGEIAAEKLFPLEPANPGNYV 583 Query: 426 LLGNLYAEAGKWDAAARVREIAKAKSLARQPGYSMIESG 310 LL N+YA G WD R+RE+ K+K L + PGYS IE G Sbjct: 584 LLSNIYASKGLWDEENRIREMMKSKGLRKNPGYSWIEVG 622