BLASTX nr result
ID: Papaver29_contig00012825
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00012825 (461 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFB74617.1| cytochrome P450 [Papaver somniferum] 66 9e-09 >gb|AFB74617.1| cytochrome P450 [Papaver somniferum] Length = 556 Score = 66.2 bits (160), Expect = 9e-09 Identities = 32/41 (78%), Positives = 36/41 (87%) Frame = -2 Query: 418 RLILEFEMKAPLGGIDMRSRRGLFNNKVVPLDVLITPRTLE 296 RLILEFEMKAP G IDMR+R G F+NKVVPLDV +TPRTL+ Sbjct: 516 RLILEFEMKAPEGKIDMRARPGFFHNKVVPLDVQLTPRTLD 556