BLASTX nr result
ID: Papaver29_contig00011188
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00011188 (1203 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010252184.1| PREDICTED: protein transport protein Sec24-l... 64 3e-07 ref|XP_010252183.1| PREDICTED: protein transport protein Sec24-l... 64 3e-07 ref|XP_002279640.2| PREDICTED: protein transport protein Sec24-l... 61 2e-06 ref|XP_656030.1| diaphanous protein, homolog 1 [Entamoeba histol... 60 3e-06 ref|XP_012089212.1| PREDICTED: protein transport protein Sec24-l... 60 4e-06 ref|XP_007925951.1| hypothetical protein MYCFIDRAFT_72224 [Pseud... 60 4e-06 gb|EMD47546.1| diaphanous family protein [Entamoeba histolytica ... 60 5e-06 ref|XP_005648472.1| RNA-binding domain-containing protein [Cocco... 59 6e-06 ref|WP_041315633.1| hypothetical protein [Saccharothrix espanaen... 59 8e-06 emb|CCH35357.1| hypothetical protein BN6_81400 [Saccharothrix es... 59 8e-06 >ref|XP_010252184.1| PREDICTED: protein transport protein Sec24-like At4g32640 isoform X2 [Nelumbo nucifera] Length = 1100 Score = 63.9 bits (154), Expect = 3e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 984 MASPVPTGVPRQQGPPPNYNPNFQQTPDGGLANNMQNLQIN 862 MASPVP GVPR PPPN+NP+ Q+TPD LA+NMQNLQIN Sbjct: 1 MASPVPPGVPRPGNPPPNFNPSVQRTPD-SLADNMQNLQIN 40 >ref|XP_010252183.1| PREDICTED: protein transport protein Sec24-like At4g32640 isoform X1 [Nelumbo nucifera] Length = 1107 Score = 63.9 bits (154), Expect = 3e-07 Identities = 30/41 (73%), Positives = 34/41 (82%) Frame = -1 Query: 984 MASPVPTGVPRQQGPPPNYNPNFQQTPDGGLANNMQNLQIN 862 MASPVP GVPR PPPN+NP+ Q+TPD LA+NMQNLQIN Sbjct: 1 MASPVPPGVPRPGNPPPNFNPSVQRTPD-SLADNMQNLQIN 40 >ref|XP_002279640.2| PREDICTED: protein transport protein Sec24-like At4g32640 [Vitis vinifera] gi|731432625|ref|XP_010644340.1| PREDICTED: protein transport protein Sec24-like At4g32640 [Vitis vinifera] gi|302143220|emb|CBI20515.3| unnamed protein product [Vitis vinifera] Length = 1124 Score = 60.8 bits (146), Expect = 2e-06 Identities = 30/44 (68%), Positives = 33/44 (75%), Gaps = 3/44 (6%) Frame = -1 Query: 984 MASPVPTGVPRQQG---PPPNYNPNFQQTPDGGLANNMQNLQIN 862 MA+PVP G PR PPPNYNPN+Q+TPD LA NMQNLQIN Sbjct: 1 MAAPVPPGAPRATNTPPPPPNYNPNYQRTPD-SLAENMQNLQIN 43 >ref|XP_656030.1| diaphanous protein, homolog 1 [Entamoeba histolytica HM-1:IMSS] gi|56473209|gb|EAL50648.1| diaphanous protein, homolog 1, putative [Entamoeba histolytica HM-1:IMSS] Length = 1176 Score = 60.5 bits (145), Expect = 3e-06 Identities = 37/79 (46%), Positives = 37/79 (46%), Gaps = 2/79 (2%) Frame = -1 Query: 249 PRAFPGSPPMGAPMDHTGGPPPPFSAGNPGMPPPFAAPNQ-GMPPPYSAQTQGMPPPFSG 73 P PG PP P G PPPP G PGMPPP P GMPPP GMPPP G Sbjct: 622 PPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPGMPGMPPPPPG 681 Query: 72 Q-GMSTQFSSPYGPPQMRP 19 GM P G P M P Sbjct: 682 MPGMPP--PPPPGMPGMPP 698 >ref|XP_012089212.1| PREDICTED: protein transport protein Sec24-like At4g32640 [Jatropha curcas] gi|643708711|gb|KDP23627.1| hypothetical protein JCGZ_23460 [Jatropha curcas] Length = 1098 Score = 60.1 bits (144), Expect = 4e-06 Identities = 26/41 (63%), Positives = 33/41 (80%) Frame = -1 Query: 984 MASPVPTGVPRQQGPPPNYNPNFQQTPDGGLANNMQNLQIN 862 MA+ VP G PRQQ PPPNYNPN+QQ P+ L++N+QNL +N Sbjct: 1 MAASVPPGAPRQQTPPPNYNPNYQQNPN-ALSDNLQNLNLN 40 >ref|XP_007925951.1| hypothetical protein MYCFIDRAFT_72224 [Pseudocercospora fijiensis CIRAD86] gi|452983603|gb|EME83361.1| hypothetical protein MYCFIDRAFT_72224 [Pseudocercospora fijiensis CIRAD86] Length = 208 Score = 60.1 bits (144), Expect = 4e-06 Identities = 38/85 (44%), Positives = 41/85 (48%), Gaps = 6/85 (7%) Frame = -1 Query: 237 PGSPPMGAPMDHTGGPP-PPFSAGNPGMPPPFAAPNQGMPPPYSAQTQGMPPPFSGQGMS 61 PG P G P G PP PP G P +PP F AP G PP ++ QG PPF G S Sbjct: 95 PGQMPPGMPPLPPGFPPMPPGGRGMPPLPPGFPAPPGGFPPGFN--PQGGMPPFPGNANS 152 Query: 60 TQ----FSSPYG-PPQMRPQFMQGG 1 FS P G PP M P F GG Sbjct: 153 PHGNMPFSPPVGMPPNMPPNFQAGG 177 >gb|EMD47546.1| diaphanous family protein [Entamoeba histolytica KU27] Length = 1246 Score = 59.7 bits (143), Expect = 5e-06 Identities = 36/79 (45%), Positives = 36/79 (45%), Gaps = 2/79 (2%) Frame = -1 Query: 249 PRAFPGSPPMGAPMDHTGGPPPPFSAGNPGMPPPFAAPNQ-GMPPPYSAQ-TQGMPPPFS 76 P PG PP P G PPPP G PGMPPP P GMPPP GMPPP Sbjct: 653 PPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPPPPGMPGMPPPPP 712 Query: 75 GQGMSTQFSSPYGPPQMRP 19 GM P G P M P Sbjct: 713 LPGMPGMPPPPPGMPGMPP 731 >ref|XP_005648472.1| RNA-binding domain-containing protein [Coccomyxa subellipsoidea C-169] gi|384250449|gb|EIE23928.1| RNA-binding domain-containing protein [Coccomyxa subellipsoidea C-169] Length = 358 Score = 59.3 bits (142), Expect = 6e-06 Identities = 37/79 (46%), Positives = 38/79 (48%), Gaps = 6/79 (7%) Frame = -1 Query: 249 PRAFPGS-PPMGAP-MDHTGGPP-PPFSAGNPGMPPP---FAAPNQGMPPPYSAQTQGMP 88 P PGS PP AP GGPP PP AG PG PPP P GMPPP G P Sbjct: 272 PMQMPGSGPPQWAPPQQQYGGPPRPPPWAGQPGGPPPPWGQPGPPMGMPPPPMGYAPGRP 331 Query: 87 PPFSGQGMSTQFSSPYGPP 31 PP G GM P+ PP Sbjct: 332 PPPPGYGMPPPGWQPHMPP 350 >ref|WP_041315633.1| hypothetical protein [Saccharothrix espanaensis] Length = 150 Score = 58.9 bits (141), Expect = 8e-06 Identities = 26/71 (36%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = -1 Query: 228 PPMGAPMDHTGGPPPPFSAGNPGMPPPFAAPNQGMPPPYSAQTQGMPPPFSGQGMSTQFS 49 P G P G PPP+ + G PPP+ ++G PP Y ++G PPP+ G S Sbjct: 43 PYAGTPQPAADGAPPPYPGTSEGAPPPYPGTSEGAPPAYPGTSEGAPPPYPGTSQPAAGS 102 Query: 48 -SPYGPPQMRP 19 PY PP P Sbjct: 103 PPPYQPPPGTP 113 >emb|CCH35357.1| hypothetical protein BN6_81400 [Saccharothrix espanaensis DSM 44229] Length = 165 Score = 58.9 bits (141), Expect = 8e-06 Identities = 26/71 (36%), Positives = 34/71 (47%), Gaps = 1/71 (1%) Frame = -1 Query: 228 PPMGAPMDHTGGPPPPFSAGNPGMPPPFAAPNQGMPPPYSAQTQGMPPPFSGQGMSTQFS 49 P G P G PPP+ + G PPP+ ++G PP Y ++G PPP+ G S Sbjct: 58 PYAGTPQPAADGAPPPYPGTSEGAPPPYPGTSEGAPPAYPGTSEGAPPPYPGTSQPAAGS 117 Query: 48 -SPYGPPQMRP 19 PY PP P Sbjct: 118 PPPYQPPPGTP 128