BLASTX nr result
ID: Papaver29_contig00011152
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00011152 (437 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAC42898.1| putative protein [Arabidopsis thaliana] 62 1e-07 gb|KJB53212.1| hypothetical protein B456_008G297000 [Gossypium r... 62 2e-07 ref|XP_012440442.1| PREDICTED: exocyst complex component SEC10-l... 62 2e-07 gb|KJB53209.1| hypothetical protein B456_008G297000 [Gossypium r... 62 2e-07 gb|KHG14635.1| Exocyst complex component 5 -like protein [Gossyp... 62 2e-07 gb|KDO86312.1| hypothetical protein CISIN_1g0032382mg [Citrus si... 62 2e-07 gb|KDO86311.1| hypothetical protein CISIN_1g0032382mg, partial [... 62 2e-07 ref|XP_006444951.1| hypothetical protein CICLE_v10018853mg [Citr... 62 2e-07 gb|ADU04144.1| hypothetical protein [Gossypium hirsutum] 62 2e-07 gb|ADU04139.1| hypothetical protein [Gossypium hirsutum] 62 2e-07 ref|XP_002275449.1| PREDICTED: exocyst complex component SEC10 [... 62 2e-07 gb|KQJ91753.1| hypothetical protein BRADI_4g39550 [Brachypodium ... 60 5e-07 ref|XP_013716529.1| PREDICTED: exocyst complex component SEC10-l... 60 5e-07 ref|XP_013622187.1| PREDICTED: exocyst complex component SEC10-l... 60 5e-07 ref|XP_013622185.1| PREDICTED: exocyst complex component SEC10-l... 60 5e-07 gb|KMZ69074.1| Exocyst complex component 5 [Zostera marina] 60 5e-07 ref|XP_010092574.1| Exocyst complex component 5 [Morus notabilis... 60 5e-07 gb|AAL87123.1|AF479280_1 SEC10 [Arabidopsis thaliana] gi|6716959... 60 5e-07 ref|XP_012484347.1| PREDICTED: exocyst complex component SEC10-l... 60 5e-07 ref|XP_012484344.1| PREDICTED: exocyst complex component SEC10-l... 60 5e-07 >emb|CAC42898.1| putative protein [Arabidopsis thaliana] Length = 863 Score = 62.4 bits (150), Expect = 1e-07 Identities = 31/33 (93%), Positives = 33/33 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQVS 339 ELENRLLSRFDAASQRR+LSTMSECAKILSQV+ Sbjct: 256 ELENRLLSRFDAASQRRDLSTMSECAKILSQVN 288 >gb|KJB53212.1| hypothetical protein B456_008G297000 [Gossypium raimondii] Length = 531 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRRELSTMSECAKILSQ Sbjct: 257 ELENRLLSRFDAASQRRELSTMSECAKILSQ 287 >ref|XP_012440442.1| PREDICTED: exocyst complex component SEC10-like [Gossypium raimondii] gi|763786139|gb|KJB53210.1| hypothetical protein B456_008G297000 [Gossypium raimondii] gi|763786140|gb|KJB53211.1| hypothetical protein B456_008G297000 [Gossypium raimondii] Length = 827 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRRELSTMSECAKILSQ Sbjct: 257 ELENRLLSRFDAASQRRELSTMSECAKILSQ 287 >gb|KJB53209.1| hypothetical protein B456_008G297000 [Gossypium raimondii] Length = 721 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRRELSTMSECAKILSQ Sbjct: 151 ELENRLLSRFDAASQRRELSTMSECAKILSQ 181 >gb|KHG14635.1| Exocyst complex component 5 -like protein [Gossypium arboreum] Length = 827 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRRELSTMSECAKILSQ Sbjct: 257 ELENRLLSRFDAASQRRELSTMSECAKILSQ 287 >gb|KDO86312.1| hypothetical protein CISIN_1g0032382mg [Citrus sinensis] Length = 732 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRRELSTMSECAKILSQ Sbjct: 267 ELENRLLSRFDAASQRRELSTMSECAKILSQ 297 >gb|KDO86311.1| hypothetical protein CISIN_1g0032382mg, partial [Citrus sinensis] Length = 783 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRRELSTMSECAKILSQ Sbjct: 267 ELENRLLSRFDAASQRRELSTMSECAKILSQ 297 >ref|XP_006444951.1| hypothetical protein CICLE_v10018853mg [Citrus clementina] gi|568876229|ref|XP_006491187.1| PREDICTED: exocyst complex component SEC10-like [Citrus sinensis] gi|557547213|gb|ESR58191.1| hypothetical protein CICLE_v10018853mg [Citrus clementina] Length = 837 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRRELSTMSECAKILSQ Sbjct: 267 ELENRLLSRFDAASQRRELSTMSECAKILSQ 297 >gb|ADU04144.1| hypothetical protein [Gossypium hirsutum] Length = 833 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRRELSTMSECAKILSQ Sbjct: 263 ELENRLLSRFDAASQRRELSTMSECAKILSQ 293 >gb|ADU04139.1| hypothetical protein [Gossypium hirsutum] Length = 833 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRRELSTMSECAKILSQ Sbjct: 263 ELENRLLSRFDAASQRRELSTMSECAKILSQ 293 >ref|XP_002275449.1| PREDICTED: exocyst complex component SEC10 [Vitis vinifera] gi|297745326|emb|CBI40406.3| unnamed protein product [Vitis vinifera] Length = 836 Score = 61.6 bits (148), Expect = 2e-07 Identities = 31/31 (100%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRRELSTMSECAKILSQ Sbjct: 267 ELENRLLSRFDAASQRRELSTMSECAKILSQ 297 >gb|KQJ91753.1| hypothetical protein BRADI_4g39550 [Brachypodium distachyon] Length = 695 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRRELSTM+ECAKILSQ Sbjct: 126 ELENRLLSRFDAASQRRELSTMAECAKILSQ 156 >ref|XP_013716529.1| PREDICTED: exocyst complex component SEC10-like [Brassica napus] Length = 826 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRR+LSTMSECAKILSQ Sbjct: 258 ELENRLLSRFDAASQRRDLSTMSECAKILSQ 288 >ref|XP_013622187.1| PREDICTED: exocyst complex component SEC10-like isoform X2 [Brassica oleracea var. oleracea] Length = 826 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRR+LSTMSECAKILSQ Sbjct: 257 ELENRLLSRFDAASQRRDLSTMSECAKILSQ 287 >ref|XP_013622185.1| PREDICTED: exocyst complex component SEC10-like isoform X1 [Brassica oleracea var. oleracea] gi|922432163|ref|XP_013622186.1| PREDICTED: exocyst complex component SEC10-like isoform X1 [Brassica oleracea var. oleracea] Length = 830 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRR+LSTMSECAKILSQ Sbjct: 261 ELENRLLSRFDAASQRRDLSTMSECAKILSQ 291 >gb|KMZ69074.1| Exocyst complex component 5 [Zostera marina] Length = 812 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRRELSTM+ECAKILSQ Sbjct: 249 ELENRLLSRFDAASQRRELSTMAECAKILSQ 279 >ref|XP_010092574.1| Exocyst complex component 5 [Morus notabilis] gi|587861789|gb|EXB51622.1| Exocyst complex component 5 [Morus notabilis] Length = 946 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLL+RFDAASQRRELSTMSECAKILSQ Sbjct: 269 ELENRLLARFDAASQRRELSTMSECAKILSQ 299 >gb|AAL87123.1|AF479280_1 SEC10 [Arabidopsis thaliana] gi|671695957|emb|CDJ79774.3| Exocyst complex subunit Sec10 [Arabidopsis thaliana] Length = 829 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLLSRFDAASQRR+LSTMSECAKILSQ Sbjct: 259 ELENRLLSRFDAASQRRDLSTMSECAKILSQ 289 >ref|XP_012484347.1| PREDICTED: exocyst complex component SEC10-like isoform X3 [Gossypium raimondii] Length = 696 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLL+RFDAASQRRELSTMSECAKILSQ Sbjct: 257 ELENRLLARFDAASQRRELSTMSECAKILSQ 287 >ref|XP_012484344.1| PREDICTED: exocyst complex component SEC10-like isoform X2 [Gossypium raimondii] Length = 739 Score = 60.5 bits (145), Expect = 5e-07 Identities = 30/31 (96%), Positives = 31/31 (100%) Frame = -1 Query: 437 ELENRLLSRFDAASQRRELSTMSECAKILSQ 345 ELENRLL+RFDAASQRRELSTMSECAKILSQ Sbjct: 257 ELENRLLARFDAASQRRELSTMSECAKILSQ 287