BLASTX nr result
ID: Papaver29_contig00008853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00008853 (2353 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEN02468.1| cyclin-dependent kinase [Camellia sinensis] 62 2e-06 gb|ABN58480.1| cyclin-dependent kinase [Actinidia chinensis] 60 7e-06 >gb|AEN02468.1| cyclin-dependent kinase [Camellia sinensis] Length = 307 Score = 62.0 bits (149), Expect = 2e-06 Identities = 34/53 (64%), Positives = 37/53 (69%), Gaps = 1/53 (1%) Frame = -1 Query: 1174 LLGTPNEYRFPGVSKLMN*DEYPQWFPQKLSFD-PNLNEAFQGLLLAVCSERP 1019 LLGTPNE +PGVSKLMN EYPQW PQKLS PNL+E Q LLL + P Sbjct: 232 LLGTPNEQVWPGVSKLMNWHEYPQWNPQKLSSAVPNLDEDGQDLLLKMLQYEP 284 >gb|ABN58480.1| cyclin-dependent kinase [Actinidia chinensis] Length = 302 Score = 60.5 bits (145), Expect = 7e-06 Identities = 33/53 (62%), Positives = 36/53 (67%), Gaps = 1/53 (1%) Frame = -1 Query: 1174 LLGTPNEYRFPGVSKLMN*DEYPQWFPQKLSFD-PNLNEAFQGLLLAVCSERP 1019 LLGTPNE +PGVSKLMN EYPQW PQKLS PNL+E LLL + P Sbjct: 227 LLGTPNEQVWPGVSKLMNWHEYPQWSPQKLSSSVPNLDEDGLDLLLKMLQYEP 279