BLASTX nr result
ID: Papaver29_contig00008775
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00008775 (995 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDO98495.1| unnamed protein product [Coffea canephora] 64 2e-07 ref|XP_010262267.1| PREDICTED: uncharacterized protein LOC104600... 62 7e-07 >emb|CDO98495.1| unnamed protein product [Coffea canephora] Length = 115 Score = 63.9 bits (154), Expect = 2e-07 Identities = 34/87 (39%), Positives = 49/87 (56%), Gaps = 1/87 (1%) Frame = -2 Query: 472 AWHNSGSVGPFFAVMAXXXXXXXXXXXXSRFCVSRTTTPPPDIR-CGGCLWWLRRKCSRC 296 AWH+SGS+GPFFAV++ R C R+ TPP +I+ GGCL WLRRK C Sbjct: 32 AWHSSGSIGPFFAVISVLTVLAVISCFAGRICKGRSVTPPENIQHGGGCLGWLRRKWCAC 91 Query: 295 VVSHGDIELGEELSVKKINNGKPPKGI 215 + ++ LG + + N+GK + + Sbjct: 92 ANNDAEV-LGN--TAAESNDGKTQESV 115 >ref|XP_010262267.1| PREDICTED: uncharacterized protein LOC104600829 [Nelumbo nucifera] Length = 118 Score = 62.0 bits (149), Expect = 7e-07 Identities = 29/60 (48%), Positives = 35/60 (58%) Frame = -2 Query: 472 AWHNSGSVGPFFAVMAXXXXXXXXXXXXSRFCVSRTTTPPPDIRCGGCLWWLRRKCSRCV 293 AWH+SGSVGPFFAV++ R CV RT TP IR L WLR++C RC+ Sbjct: 27 AWHSSGSVGPFFAVISVLTVLAVLSCVFGRVCVDRTVTPLESIRHRSYLDWLRQRCRRCI 86