BLASTX nr result
ID: Papaver29_contig00008446
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00008446 (959 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007021323.1| F-box and associated interaction domains-con... 60 2e-06 ref|XP_009609767.1| PREDICTED: F-box protein CPR30-like [Nicotia... 59 7e-06 >ref|XP_007021323.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590608658|ref|XP_007021324.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|590608661|ref|XP_007021325.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508720951|gb|EOY12848.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508720952|gb|EOY12849.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] gi|508720953|gb|EOY12850.1| F-box and associated interaction domains-containing protein, putative isoform 1 [Theobroma cacao] Length = 398 Score = 60.5 bits (145), Expect = 2e-06 Identities = 61/204 (29%), Positives = 86/204 (42%), Gaps = 4/204 (1%) Frame = -3 Query: 957 FFNLEKDGSDEYNFKLLH-KHESQGRSIEPVGNCNGLSCFQRMGISPGSEEIIIVNPFRR 781 F + + D DEY K LH +S VG+CNGL C Q S E+I+ NP + Sbjct: 71 FLHFDNDDFDEY--KQLHFPFKSNSPWFRLVGSCNGLVCLQDGFFPLDSVELILWNPSIQ 128 Query: 780 ETLNLICLIPKIGGG--GGSLKYLCHGFGFDLLSQEYKVVLIYTTSTSEGDRGFICMVL- 610 + + L PK G G GFGFD + +YK++ + + S E + L Sbjct: 129 KYITL----PKPGVTCLSGRAYNSTLGFGFDSRTNDYKLLNVVSMSVGEEAETLTEVYLF 184 Query: 609 TLGVRSWRKVVTSTCDILPPPGCSPFPSQMVTTMWKKDHRSAAICGGDLLWRITHTGSLD 430 +L SW++V I P G + H +A G + W + + D Sbjct: 185 SLDGNSWKRVTA----ISPKYGI-------------EGHEFSAFVNGAVHW-LGYQRGKD 226 Query: 429 GNKIEMLLSFDIHNEKIQFIGLPE 358 G M+L FDI EK I LPE Sbjct: 227 GGFRNMVLGFDISTEKFNVIRLPE 250 >ref|XP_009609767.1| PREDICTED: F-box protein CPR30-like [Nicotiana tomentosiformis] Length = 320 Score = 58.5 bits (140), Expect = 7e-06 Identities = 36/101 (35%), Positives = 50/101 (49%), Gaps = 4/101 (3%) Frame = -3 Query: 870 VGNCNGLSCFQRMGISPGSEEIIIVNPFRRETLNLICLIPKIGGGGGSLKYLCHGFGFDL 691 VG+ +GL C RM G +++ I NP RE + L P++ G + +GFG D Sbjct: 113 VGSIHGLVCLFRMHCDSGLDDVYIFNPTTREYITL----PEVKGLRKYPNLVTYGFGLDP 168 Query: 690 LSQEYKVVLIYTTSTSEGDRGFI----CMVLTLGVRSWRKV 580 + EYKVV IY T + +G V TLG SWR + Sbjct: 169 VRMEYKVVRIYQVETHDPAKGAYYTSEVQVYTLGTGSWRSI 209