BLASTX nr result
ID: Papaver29_contig00006405
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00006405 (673 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010277446.1| PREDICTED: ankyrin repeat and zinc finger do... 67 6e-12 ref|XP_004229826.1| PREDICTED: ankyrin repeat and zinc finger do... 68 8e-12 ref|XP_006339446.1| PREDICTED: ankyrin repeat and zinc finger do... 68 8e-12 ref|XP_011090984.1| PREDICTED: ankyrin repeat and zinc finger do... 65 1e-10 ref|XP_009770763.1| PREDICTED: ankyrin repeat and zinc finger do... 64 1e-10 ref|XP_009605450.1| PREDICTED: ankyrin repeat and zinc finger do... 64 1e-10 emb|CDP17791.1| unnamed protein product [Coffea canephora] 67 2e-10 ref|XP_010692314.1| PREDICTED: ankyrin repeat and zinc finger do... 60 2e-10 ref|XP_009397504.1| PREDICTED: ankyrin repeat and zinc finger do... 63 4e-09 ref|XP_012473352.1| PREDICTED: ankyrin repeat and zinc finger do... 68 6e-09 gb|KHG29693.1| Ankyrin repeat and zinc finger domain-containing ... 68 6e-09 ref|XP_007052019.1| Zinc finger protein-related [Theobroma cacao... 68 6e-09 gb|KDO85868.1| hypothetical protein CISIN_1g005932mg [Citrus sin... 66 2e-08 ref|XP_006445227.1| hypothetical protein CICLE_v10019178mg [Citr... 66 2e-08 ref|XP_010092858.1| hypothetical protein L484_022453 [Morus nota... 66 2e-08 ref|XP_010919422.1| PREDICTED: uncharacterized protein LOC105043... 66 2e-08 gb|KNA25810.1| hypothetical protein SOVF_003120 isoform B [Spina... 60 4e-08 gb|KNA25809.1| hypothetical protein SOVF_003120 isoform A [Spina... 60 4e-08 ref|XP_006858020.2| PREDICTED: LOW QUALITY PROTEIN: ankyrin repe... 64 6e-08 gb|ERN19487.1| hypothetical protein AMTR_s00069p00197120 [Ambore... 64 6e-08 >ref|XP_010277446.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1 isoform X1 [Nelumbo nucifera] Length = 711 Score = 67.4 bits (163), Expect(2) = 6e-12 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KAEFESLQDQR HFKSD HRFN+KLSI+GK+TIKEE F Sbjct: 120 KAEFESLQDQRLHFKSDIHRFNVKLSIAGKNTIKEEDF 157 Score = 30.4 bits (67), Expect(2) = 6e-12 Identities = 15/21 (71%), Positives = 18/21 (85%) Frame = +3 Query: 609 FDELASDSVFRDYDDMSSISG 671 FDEL SDS+F+D D+SSISG Sbjct: 157 FDELTSDSLFKD-SDISSISG 176 >ref|XP_004229826.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1 [Solanum lycopersicum] Length = 694 Score = 67.8 bits (164), Expect(2) = 8e-12 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KAEFESL DQRSHFKSD HR NIKLSISG+DTIKEE F Sbjct: 104 KAEFESLHDQRSHFKSDIHRLNIKLSISGRDTIKEEDF 141 Score = 29.6 bits (65), Expect(2) = 8e-12 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 609 FDELASDSVFRDYDDMSSISG 671 FDE+ SDS+ +DY D+SSISG Sbjct: 141 FDEMTSDSLCKDY-DLSSISG 160 >ref|XP_006339446.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1-like [Solanum tuberosum] Length = 693 Score = 67.8 bits (164), Expect(2) = 8e-12 Identities = 33/38 (86%), Positives = 34/38 (89%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KAEFESL DQRSHFKSD HR NIKLSISG+DTIKEE F Sbjct: 106 KAEFESLHDQRSHFKSDIHRLNIKLSISGRDTIKEEDF 143 Score = 29.6 bits (65), Expect(2) = 8e-12 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 609 FDELASDSVFRDYDDMSSISG 671 FDE+ SDS+ +DY D+SSISG Sbjct: 143 FDEMTSDSLCKDY-DLSSISG 162 >ref|XP_011090984.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1 [Sesamum indicum] Length = 697 Score = 65.5 bits (158), Expect(2) = 1e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KAEFESLQDQR HFKSD HRFNIKLSI+GK+ IKEE F Sbjct: 105 KAEFESLQDQRFHFKSDLHRFNIKLSIAGKNIIKEEDF 142 Score = 28.1 bits (61), Expect(2) = 1e-10 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 609 FDELASDSVFRDYDDMSSISG 671 FDE SDS+ +DY D+SSISG Sbjct: 142 FDEATSDSLCKDY-DVSSISG 161 >ref|XP_009770763.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1 [Nicotiana sylvestris] Length = 693 Score = 63.9 bits (154), Expect(2) = 1e-10 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KA FESL DQRSHFKSD HR NIKLSI+G+DTIKEE F Sbjct: 104 KAVFESLHDQRSHFKSDIHRLNIKLSIAGRDTIKEEDF 141 Score = 29.3 bits (64), Expect(2) = 1e-10 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 609 FDELASDSVFRDYDDMSSISG 671 FDE+ SDS+ +DY D+SSISG Sbjct: 141 FDEMKSDSLCKDY-DLSSISG 160 >ref|XP_009605450.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1 [Nicotiana tomentosiformis] Length = 693 Score = 63.9 bits (154), Expect(2) = 1e-10 Identities = 31/38 (81%), Positives = 33/38 (86%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KA FESL DQRSHFKSD HR NIKLSI+G+DTIKEE F Sbjct: 104 KAVFESLHDQRSHFKSDIHRLNIKLSIAGRDTIKEEDF 141 Score = 29.3 bits (64), Expect(2) = 1e-10 Identities = 14/21 (66%), Positives = 18/21 (85%) Frame = +3 Query: 609 FDELASDSVFRDYDDMSSISG 671 FDE+ SDS+ +DY D+SSISG Sbjct: 141 FDEMKSDSLCKDY-DLSSISG 160 >emb|CDP17791.1| unnamed protein product [Coffea canephora] Length = 697 Score = 66.6 bits (161), Expect(2) = 2e-10 Identities = 32/38 (84%), Positives = 34/38 (89%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KAEFESLQDQRSHFKSD HR NIKLSI+GK T+KEE F Sbjct: 104 KAEFESLQDQRSHFKSDIHRLNIKLSIAGKGTVKEEDF 141 Score = 26.2 bits (56), Expect(2) = 2e-10 Identities = 13/21 (61%), Positives = 17/21 (80%) Frame = +3 Query: 609 FDELASDSVFRDYDDMSSISG 671 F+E SDS+ +DY D+SSISG Sbjct: 141 FNETTSDSLCKDY-DVSSISG 160 >ref|XP_010692314.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1 [Beta vulgaris subsp. vulgaris] gi|870847807|gb|KMT00155.1| hypothetical protein BVRB_1g019730 [Beta vulgaris subsp. vulgaris] Length = 682 Score = 60.1 bits (144), Expect(2) = 2e-10 Identities = 27/38 (71%), Positives = 33/38 (86%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 K+EFESL DQRSHFKSD HRFN+KLS++GK +KE+ F Sbjct: 91 KSEFESLLDQRSHFKSDLHRFNVKLSLAGKKILKEDDF 128 Score = 32.7 bits (73), Expect(2) = 2e-10 Identities = 14/21 (66%), Positives = 17/21 (80%) Frame = +3 Query: 609 FDELASDSVFRDYDDMSSISG 671 FDEL DS +D+DD+SSISG Sbjct: 128 FDELTPDSFSKDFDDVSSISG 148 >ref|XP_009397504.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1 [Musa acuminata subsp. malaccensis] Length = 677 Score = 62.8 bits (151), Expect(2) = 4e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KAEF+SLQDQRSHFKSD HR N+KLSI+GK+ IKE+ F Sbjct: 91 KAEFDSLQDQRSHFKSDLHRLNVKLSIAGKNIIKEDDF 128 Score = 25.4 bits (54), Expect(2) = 4e-09 Identities = 12/21 (57%), Positives = 15/21 (71%) Frame = +3 Query: 609 FDELASDSVFRDYDDMSSISG 671 FD L D V+ D+ D+SSISG Sbjct: 128 FDNLGGDPVYEDF-DVSSISG 147 >ref|XP_012473352.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1 [Gossypium raimondii] gi|763754998|gb|KJB22329.1| hypothetical protein B456_004G041400 [Gossypium raimondii] Length = 684 Score = 67.8 bits (164), Expect = 6e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KAEF+SLQDQRSHFKSD HRFN+KLSI+GKD +KEE F Sbjct: 87 KAEFDSLQDQRSHFKSDIHRFNVKLSIAGKDIVKEEDF 124 >gb|KHG29693.1| Ankyrin repeat and zinc finger domain-containing 1 [Gossypium arboreum] Length = 686 Score = 67.8 bits (164), Expect = 6e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KAEF+SLQDQRSHFKSD HRFN+KLSI+GKD +KEE F Sbjct: 88 KAEFDSLQDQRSHFKSDIHRFNVKLSIAGKDIVKEEDF 125 >ref|XP_007052019.1| Zinc finger protein-related [Theobroma cacao] gi|508704280|gb|EOX96176.1| Zinc finger protein-related [Theobroma cacao] Length = 672 Score = 67.8 bits (164), Expect = 6e-09 Identities = 31/38 (81%), Positives = 35/38 (92%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KAEF+SLQDQRSHFKSD HRFN+KLSI+GKD +KEE F Sbjct: 85 KAEFDSLQDQRSHFKSDVHRFNVKLSIAGKDIVKEEDF 122 >gb|KDO85868.1| hypothetical protein CISIN_1g005932mg [Citrus sinensis] Length = 669 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 K EFESLQDQRSHFKSD HRFN+KL+I+GKD +KEE F Sbjct: 85 KTEFESLQDQRSHFKSDVHRFNVKLTIAGKDIVKEEDF 122 >ref|XP_006445227.1| hypothetical protein CICLE_v10019178mg [Citrus clementina] gi|568875734|ref|XP_006490947.1| PREDICTED: ankyrin repeat and zinc finger domain-containing protein 1-like [Citrus sinensis] gi|557547489|gb|ESR58467.1| hypothetical protein CICLE_v10019178mg [Citrus clementina] Length = 669 Score = 66.2 bits (160), Expect = 2e-08 Identities = 30/38 (78%), Positives = 34/38 (89%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 K EFESLQDQRSHFKSD HRFN+KL+I+GKD +KEE F Sbjct: 85 KTEFESLQDQRSHFKSDVHRFNVKLTIAGKDIVKEEDF 122 >ref|XP_010092858.1| hypothetical protein L484_022453 [Morus notabilis] gi|587862891|gb|EXB52676.1| hypothetical protein L484_022453 [Morus notabilis] Length = 679 Score = 65.9 bits (159), Expect = 2e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KAEFESLQDQRSHFKSD HRFN+KLSI+GK+ +KE+ F Sbjct: 96 KAEFESLQDQRSHFKSDIHRFNVKLSIAGKNIVKEDDF 133 >ref|XP_010919422.1| PREDICTED: uncharacterized protein LOC105043544 [Elaeis guineensis] Length = 1261 Score = 65.9 bits (159), Expect = 2e-08 Identities = 30/38 (78%), Positives = 35/38 (92%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 KAEF+SLQDQRSHFKSD HR N+KLSI+GK+T+KEE F Sbjct: 88 KAEFDSLQDQRSHFKSDLHRLNVKLSIAGKNTVKEEDF 125 >gb|KNA25810.1| hypothetical protein SOVF_003120 isoform B [Spinacia oleracea] Length = 701 Score = 60.5 bits (145), Expect(2) = 4e-08 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = +1 Query: 460 CQVCLALKMKLRKAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 C +C K+EFESL DQRSHFKSD HRFN+KLS++GK +KE+ F Sbjct: 91 CNIC--------KSEFESLLDQRSHFKSDLHRFNVKLSLAGKVVLKEDDF 132 Score = 24.6 bits (52), Expect(2) = 4e-08 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +3 Query: 609 FDELASDSVFRDYDDMSSISG 671 FDEL DS +D+ D+SSISG Sbjct: 132 FDELNYDSFSKDF-DVSSISG 151 >gb|KNA25809.1| hypothetical protein SOVF_003120 isoform A [Spinacia oleracea] Length = 683 Score = 60.5 bits (145), Expect(2) = 4e-08 Identities = 29/50 (58%), Positives = 36/50 (72%) Frame = +1 Query: 460 CQVCLALKMKLRKAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 C +C K+EFESL DQRSHFKSD HRFN+KLS++GK +KE+ F Sbjct: 91 CNIC--------KSEFESLLDQRSHFKSDLHRFNVKLSLAGKVVLKEDDF 132 Score = 24.6 bits (52), Expect(2) = 4e-08 Identities = 13/21 (61%), Positives = 16/21 (76%) Frame = +3 Query: 609 FDELASDSVFRDYDDMSSISG 671 FDEL DS +D+ D+SSISG Sbjct: 132 FDELNYDSFSKDF-DVSSISG 151 >ref|XP_006858020.2| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat and zinc finger domain-containing protein 1 [Amborella trichopoda] Length = 685 Score = 64.3 bits (155), Expect = 6e-08 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 K+EFESL++QRSHFKSD HRFN+KLS++GK T+KEE F Sbjct: 86 KSEFESLEEQRSHFKSDIHRFNVKLSLAGKSTVKEEDF 123 >gb|ERN19487.1| hypothetical protein AMTR_s00069p00197120 [Amborella trichopoda] Length = 440 Score = 64.3 bits (155), Expect = 6e-08 Identities = 28/38 (73%), Positives = 35/38 (92%) Frame = +1 Query: 496 KAEFESLQDQRSHFKSDHHRFNIKLSISGKDTIKEEFF 609 K+EFESL++QRSHFKSD HRFN+KLS++GK T+KEE F Sbjct: 86 KSEFESLEEQRSHFKSDIHRFNVKLSLAGKSTVKEEDF 123