BLASTX nr result
ID: Papaver29_contig00006179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00006179 (1572 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDP37936.1| hypothetical protein JCGZ_04579 [Jatropha curcas] 60 5e-06 >gb|KDP37936.1| hypothetical protein JCGZ_04579 [Jatropha curcas] Length = 227 Score = 60.1 bits (144), Expect = 5e-06 Identities = 29/71 (40%), Positives = 46/71 (64%) Frame = -3 Query: 1369 KRKDAIKKIENEQERLAEFERRRKELQEEACAISSETGAEIDLVGFTPDGRTFNFGSTSD 1190 ++K +KKIENE +RL F +RR + ++AC + + TGAEI V F+P G+ F+F S Sbjct: 12 RQKIEMKKIENEDDRLITFSKRRSGIYKKACELVTLTGAEIAFVVFSPAGKPFSFAHPSI 71 Query: 1189 GKMYDRFISEE 1157 + +RF+ +E Sbjct: 72 ESVTNRFLGKE 82