BLASTX nr result
ID: Papaver29_contig00006032
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00006032 (1855 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AGC78943.1| hypothetical protein (mitochondrion) [Vicia faba] 69 1e-08 gb|EPS74490.1| hypothetical protein M569_00256 [Genlisea aurea] 62 1e-06 >gb|AGC78943.1| hypothetical protein (mitochondrion) [Vicia faba] Length = 135 Score = 68.9 bits (167), Expect = 1e-08 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = +1 Query: 292 DQHAAVNLYPGPVHTARHTLGIGFARSIGSMIT 390 DQHAAVN+YPGPVHTARHTLGIGFARSIG MIT Sbjct: 73 DQHAAVNMYPGPVHTARHTLGIGFARSIGPMIT 105 >gb|EPS74490.1| hypothetical protein M569_00256 [Genlisea aurea] Length = 184 Score = 62.4 bits (150), Expect = 1e-06 Identities = 28/31 (90%), Positives = 29/31 (93%) Frame = +1 Query: 295 QHAAVNLYPGPVHTARHTLGIGFARSIGSMI 387 QHAAVN+YPGPVHTARHTLGIGFARSIG I Sbjct: 123 QHAAVNMYPGPVHTARHTLGIGFARSIGPTI 153