BLASTX nr result
ID: Papaver29_contig00004301
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00004301 (421 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KRH03137.1| hypothetical protein GLYMA_17G078700 [Glycine max] 56 9e-06 ref|XP_006600581.1| PREDICTED: replication protein A 70 kDa DNA-... 56 9e-06 >gb|KRH03137.1| hypothetical protein GLYMA_17G078700 [Glycine max] Length = 527 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -2 Query: 366 SIHVSLWNGLATTMGQELLDVLDSDLIMAIKSLKVGNLQG 247 ++ VSLWN LATT GQELLD++D ++AIKSLKVG+ QG Sbjct: 348 TVVVSLWNELATTTGQELLDIVDKSPVVAIKSLKVGDFQG 387 >ref|XP_006600581.1| PREDICTED: replication protein A 70 kDa DNA-binding subunit D-like [Glycine max] gi|734367712|gb|KHN18358.1| Replication protein A 70 kDa DNA-binding subunit [Glycine soja] gi|947053683|gb|KRH03136.1| hypothetical protein GLYMA_17G078700 [Glycine max] Length = 619 Score = 56.2 bits (134), Expect = 9e-06 Identities = 26/40 (65%), Positives = 33/40 (82%) Frame = -2 Query: 366 SIHVSLWNGLATTMGQELLDVLDSDLIMAIKSLKVGNLQG 247 ++ VSLWN LATT GQELLD++D ++AIKSLKVG+ QG Sbjct: 348 TVVVSLWNELATTTGQELLDIVDKSPVVAIKSLKVGDFQG 387