BLASTX nr result
ID: Papaver29_contig00002548
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00002548 (1036 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002987288.1| hypothetical protein SELMODRAFT_269256 [Sela... 45 4e-06 >ref|XP_002987288.1| hypothetical protein SELMODRAFT_269256 [Selaginella moellendorffii] gi|302815025|ref|XP_002989195.1| hypothetical protein SELMODRAFT_269487 [Selaginella moellendorffii] gi|300143095|gb|EFJ09789.1| hypothetical protein SELMODRAFT_269487 [Selaginella moellendorffii] gi|300144923|gb|EFJ11603.1| hypothetical protein SELMODRAFT_269256 [Selaginella moellendorffii] Length = 567 Score = 45.4 bits (106), Expect(2) = 4e-06 Identities = 23/60 (38%), Positives = 34/60 (56%) Frame = -2 Query: 504 DIATLCGTIGPVSRVIGPELYEGPEHLRLLVTFENKEDAVKAIDTLNGSLFKGRVLTVER 325 D+ L G GP+S + + +G V FEN EDAVKA++ L+G+ F+ + L V R Sbjct: 207 DLQKLFGVFGPISSAVVMKEVDGKSKCFGFVNFENPEDAVKAVEDLHGTTFQDKELYVSR 266 Score = 33.9 bits (76), Expect(2) = 4e-06 Identities = 21/60 (35%), Positives = 30/60 (50%), Gaps = 7/60 (11%) Frame = -1 Query: 781 KNLPAGILNSNLKRLCLDYGPVVRVEIMRNVGQVS-------FENREGAQMAIDKLNGST 623 KNL I N L L YG ++ +I +V VS F+ + A AI+K+NG+T Sbjct: 108 KNLDKSIDNKALHDLFSPYGKILSCKIALDVSNVSKGHGFVQFDTEDAAHTAIEKINGTT 167