BLASTX nr result
ID: Papaver29_contig00001445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00001445 (493 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010252286.1| PREDICTED: 2-C-methyl-D-erythritol 4-phospha... 57 5e-06 >ref|XP_010252286.1| PREDICTED: 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase, chloroplastic [Nelumbo nucifera] Length = 309 Score = 57.0 bits (136), Expect = 5e-06 Identities = 33/67 (49%), Positives = 38/67 (56%), Gaps = 3/67 (4%) Frame = -3 Query: 194 FHHQIPVRKSESHRKKTRITCXXXXXXXXXXXXXXXXXVL---LLAGGKGTRMGASMPKQ 24 FHHQIP R++ R RI+C + LLAGGKG RMGASMPKQ Sbjct: 44 FHHQIPGRRTRFGRN-VRISCYAKTGEAIQNSENVKDRSISVVLLAGGKGKRMGASMPKQ 102 Query: 23 YIPLLGQ 3 Y+PLLGQ Sbjct: 103 YLPLLGQ 109