BLASTX nr result
ID: Papaver29_contig00000403
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver29_contig00000403 (550 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006350016.1| PREDICTED: leucine-rich repeat extensin-like... 57 4e-06 ref|XP_004251814.1| PREDICTED: protodermal factor 1-like [Solanu... 57 4e-06 ref|XP_009798270.1| PREDICTED: protodermal factor 1-like [Nicoti... 56 1e-05 ref|XP_009598266.1| PREDICTED: protodermal factor 1-like [Nicoti... 56 1e-05 ref|XP_010035900.1| PREDICTED: protodermal factor 1-like [Eucaly... 56 1e-05 >ref|XP_006350016.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like [Solanum tuberosum] Length = 656 Score = 57.4 bits (137), Expect = 4e-06 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 186 LIPDDPNLPPFIGTCDFWRTHPTMVWGLFGW 94 + P DPN PPF TC++WRTHPT++WGLFGW Sbjct: 538 VFPIDPNSPPF--TCNYWRTHPTLIWGLFGW 566 >ref|XP_004251814.1| PREDICTED: protodermal factor 1-like [Solanum lycopersicum] Length = 407 Score = 57.4 bits (137), Expect = 4e-06 Identities = 21/31 (67%), Positives = 26/31 (83%) Frame = -2 Query: 186 LIPDDPNLPPFIGTCDFWRTHPTMVWGLFGW 94 + P DPN PPF TC++WRTHPT++WGLFGW Sbjct: 289 VFPIDPNSPPF--TCNYWRTHPTLIWGLFGW 317 >ref|XP_009798270.1| PREDICTED: protodermal factor 1-like [Nicotiana sylvestris] Length = 348 Score = 56.2 bits (134), Expect = 1e-05 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -2 Query: 186 LIPDDPNLPPFIGTCDFWRTHPTMVWGLFGW 94 + P DPN PPF TCD+WRTHPT++WG+ GW Sbjct: 226 VFPIDPNSPPF--TCDYWRTHPTLIWGILGW 254 >ref|XP_009598266.1| PREDICTED: protodermal factor 1-like [Nicotiana tomentosiformis] Length = 325 Score = 56.2 bits (134), Expect = 1e-05 Identities = 20/31 (64%), Positives = 25/31 (80%) Frame = -2 Query: 186 LIPDDPNLPPFIGTCDFWRTHPTMVWGLFGW 94 + P DPN PPF TCD+WRTHPT++WG+ GW Sbjct: 203 VFPIDPNSPPF--TCDYWRTHPTLIWGILGW 231 >ref|XP_010035900.1| PREDICTED: protodermal factor 1-like [Eucalyptus grandis] gi|629080960|gb|KCW47405.1| hypothetical protein EUGRSUZ_K01198 [Eucalyptus grandis] Length = 318 Score = 56.2 bits (134), Expect = 1e-05 Identities = 20/29 (68%), Positives = 23/29 (79%) Frame = -2 Query: 180 PDDPNLPPFIGTCDFWRTHPTMVWGLFGW 94 P DPN PF GTC+FWRTHP ++WGL GW Sbjct: 196 PFDPNSNPFTGTCNFWRTHPGVIWGLLGW 224