BLASTX nr result
ID: Papaver27_contig00056676
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00056676 (569 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006424630.1| hypothetical protein CICLE_v10028524mg [Citr... 81 2e-13 ref|XP_004167072.1| PREDICTED: pentatricopeptide repeat-containi... 73 6e-11 ref|XP_004147297.1| PREDICTED: pentatricopeptide repeat-containi... 73 6e-11 ref|XP_002324476.2| hypothetical protein POPTR_0018s10150g [Popu... 72 1e-10 ref|XP_004237999.1| PREDICTED: pentatricopeptide repeat-containi... 70 5e-10 emb|CBI16275.3| unnamed protein product [Vitis vinifera] 70 5e-10 ref|XP_006593024.1| PREDICTED: pentatricopeptide repeat-containi... 69 1e-09 ref|NP_001154742.1| pentatricopeptide (PPR) repeat-containing pr... 69 1e-09 ref|XP_007132184.1| hypothetical protein PHAVU_011G073100g [Phas... 68 1e-09 ref|NP_198082.4| pentatricopeptide (PPR) repeat-containing prote... 68 1e-09 ref|XP_006338053.1| PREDICTED: pentatricopeptide repeat-containi... 67 3e-09 ref|XP_006294242.1| hypothetical protein CARUB_v10023241mg [Caps... 67 3e-09 ref|NP_180348.2| pentatricopeptide repeat-containing protein [Ar... 67 3e-09 ref|XP_007015464.1| Tetratricopeptide repeat-like superfamily pr... 67 3e-09 ref|XP_006829818.1| hypothetical protein AMTR_s00119p00084460 [A... 67 4e-09 ref|XP_004309881.1| PREDICTED: pentatricopeptide repeat-containi... 66 7e-09 gb|EPS72326.1| hypothetical protein M569_02437, partial [Genlise... 65 1e-08 ref|XP_002879134.1| hypothetical protein ARALYDRAFT_481728 [Arab... 65 1e-08 ref|XP_007206500.1| hypothetical protein PRUPE_ppa019170mg [Prun... 65 1e-08 gb|AAC73020.1| hypothetical protein [Arabidopsis thaliana] 64 2e-08 >ref|XP_006424630.1| hypothetical protein CICLE_v10028524mg [Citrus clementina] gi|568869886|ref|XP_006488146.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Citrus sinensis] gi|557526564|gb|ESR37870.1| hypothetical protein CICLE_v10028524mg [Citrus clementina] Length = 417 Score = 81.3 bits (199), Expect = 2e-13 Identities = 43/89 (48%), Positives = 54/89 (60%) Frame = -1 Query: 269 SECSICSLYSLPQRTLSTKVSQYNRKHKKSKCADGPPLTAAQTEQIVSELPPRFDSEDLC 90 S +CS YS ++ S K+SK P L Q VSELPPRF++E+LC Sbjct: 53 SNAILCSCYS----AIALSRSSGRGVGKRSKADSKPALDDTQFRCAVSELPPRFNNEELC 108 Query: 89 RTITLQKDPRACLELFKYASKQPRFRHNA 3 +TLQ+DP CLELF +ASKQPRFRH+A Sbjct: 109 NVMTLQEDPLVCLELFNWASKQPRFRHDA 137 >ref|XP_004167072.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Cucumis sativus] Length = 428 Score = 72.8 bits (177), Expect = 6e-11 Identities = 33/64 (51%), Positives = 45/64 (70%) Frame = -1 Query: 197 RKHKKSKCADGPPLTAAQTEQIVSELPPRFDSEDLCRTITLQKDPRACLELFKYASKQPR 18 R +K+ K + P L Q + VS++PPRF SE+LC I+LQ+DP C ELF +AS+QPR Sbjct: 89 RANKRLKSSLKPKLDETQFQLAVSKIPPRFTSEELCNVISLQRDPLVCFELFNWASQQPR 148 Query: 17 FRHN 6 FRH+ Sbjct: 149 FRHD 152 >ref|XP_004147297.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Cucumis sativus] Length = 428 Score = 72.8 bits (177), Expect = 6e-11 Identities = 33/64 (51%), Positives = 45/64 (70%) Frame = -1 Query: 197 RKHKKSKCADGPPLTAAQTEQIVSELPPRFDSEDLCRTITLQKDPRACLELFKYASKQPR 18 R +K+ K + P L Q + VS++PPRF SE+LC I+LQ+DP C ELF +AS+QPR Sbjct: 89 RANKRLKSSLKPKLDETQFQLAVSKIPPRFTSEELCNVISLQRDPLVCFELFNWASQQPR 148 Query: 17 FRHN 6 FRH+ Sbjct: 149 FRHD 152 >ref|XP_002324476.2| hypothetical protein POPTR_0018s10150g [Populus trichocarpa] gi|550318443|gb|EEF03041.2| hypothetical protein POPTR_0018s10150g [Populus trichocarpa] Length = 400 Score = 71.6 bits (174), Expect = 1e-10 Identities = 40/93 (43%), Positives = 57/93 (61%), Gaps = 3/93 (3%) Frame = -1 Query: 272 YSECSICSLYSLPQRTLSTKV---SQYNRKHKKSKCADGPPLTAAQTEQIVSELPPRFDS 102 +++ I + YS STK S R +K++K P L A+ ++ VS+LP RF + Sbjct: 27 HTDTEIDAEYSNFSTFYSTKAPSRSFRKRNNKRAKANSRPILDEAKFQRSVSQLPSRFTN 86 Query: 101 EDLCRTITLQKDPRACLELFKYASKQPRFRHNA 3 E+LC ITL+ DP CLELF +AS+Q RFRH+A Sbjct: 87 EELCNNITLEDDPLVCLELFNWASQQHRFRHDA 119 >ref|XP_004237999.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like isoform 1 [Solanum lycopersicum] gi|460384604|ref|XP_004238000.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like isoform 2 [Solanum lycopersicum] Length = 451 Score = 69.7 bits (169), Expect = 5e-10 Identities = 40/92 (43%), Positives = 54/92 (58%) Frame = -1 Query: 281 VSKYSECSICSLYSLPQRTLSTKVSQYNRKHKKSKCADGPPLTAAQTEQIVSELPPRFDS 102 VS YS + L P R+L R +++++ A P L +Q + VS+LPPRF Sbjct: 87 VSFYSSSAPGWLRGPPSRSLR------KRMNRRARIAAMPVLDESQFQNAVSQLPPRFTP 140 Query: 101 EDLCRTITLQKDPRACLELFKYASKQPRFRHN 6 E+L + LQ+DP CLELF +ASKQ RFRHN Sbjct: 141 EELRDVMVLQRDPLVCLELFNWASKQHRFRHN 172 >emb|CBI16275.3| unnamed protein product [Vitis vinifera] Length = 441 Score = 69.7 bits (169), Expect = 5e-10 Identities = 44/106 (41%), Positives = 57/106 (53%), Gaps = 1/106 (0%) Frame = -1 Query: 320 LFTPNPIPPNTYSVSKYSECSI-CSLYSLPQRTLSTKVSQYNRKHKKSKCADGPPLTAAQ 144 L T I N+Y KY+ S CS S R+ R K+ K P L AQ Sbjct: 62 LSTQIQIGSNSY---KYTHLSFYCSYSSGAFRSFK------KRARKRLKANAKPCLNEAQ 112 Query: 143 TEQIVSELPPRFDSEDLCRTITLQKDPRACLELFKYASKQPRFRHN 6 Q +SEL PRF + +LC + LQ+DP CLE+F +AS+QPRFRH+ Sbjct: 113 FHQAISELLPRFSAGELCEVLNLQEDPIVCLEIFNWASQQPRFRHD 158 >ref|XP_006593024.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like, partial [Glycine max] Length = 574 Score = 68.6 bits (166), Expect = 1e-09 Identities = 33/68 (48%), Positives = 42/68 (61%) Frame = -1 Query: 209 SQYNRKHKKSKCADGPPLTAAQTEQIVSELPPRFDSEDLCRTITLQKDPRACLELFKYAS 30 S R K+ + P L AQ + +S+LPPRF E+LC I Q DP CLELF +AS Sbjct: 164 SYQRRARKRLLKSSKPTLDQAQFQLALSQLPPRFTPEELCNVIARQNDPLVCLELFHWAS 223 Query: 29 KQPRFRHN 6 +QPRFRH+ Sbjct: 224 QQPRFRHD 231 >ref|NP_001154742.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] gi|332006287|gb|AED93670.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] Length = 550 Score = 68.6 bits (166), Expect = 1e-09 Identities = 37/98 (37%), Positives = 59/98 (60%), Gaps = 2/98 (2%) Frame = -1 Query: 296 PNTYSVSKYSECSICSLYS--LPQRTLSTKVSQYNRKHKKSKCADGPPLTAAQTEQIVSE 123 P + + + S+C+ YS +P R+L ++S +RK +K P L ++ ++ +S+ Sbjct: 47 PQSQIEGRLASVSMCTQYSTSVPTRSLRRRIS--SRKKSSTK----PILNESKFQETISK 100 Query: 122 LPPRFDSEDLCRTITLQKDPRACLELFKYASKQPRFRH 9 LPPRF E+L ITL++DP C LF +AS+QPRF H Sbjct: 101 LPPRFTPEELADAITLEEDPFLCFHLFNWASQQPRFTH 138 >ref|XP_007132184.1| hypothetical protein PHAVU_011G073100g [Phaseolus vulgaris] gi|561005184|gb|ESW04178.1| hypothetical protein PHAVU_011G073100g [Phaseolus vulgaris] Length = 439 Score = 68.2 bits (165), Expect = 1e-09 Identities = 42/104 (40%), Positives = 56/104 (53%) Frame = -1 Query: 317 FTPNPIPPNTYSVSKYSECSICSLYSLPQRTLSTKVSQYNRKHKKSKCADGPPLTAAQTE 138 +T P+P +S S YS + S + NR K SK P L AQ + Sbjct: 66 YTQFPVPFAPFSFS----------YSTKAPSRSYRRRARNRLLKSSK----PTLDQAQFQ 111 Query: 137 QIVSELPPRFDSEDLCRTITLQKDPRACLELFKYASKQPRFRHN 6 +S+LPPRF +E+LC I+ Q P CLELF +AS+QPRFRH+ Sbjct: 112 LALSQLPPRFTTEELCSVISQQDHPLVCLELFHWASQQPRFRHD 155 >ref|NP_198082.4| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] gi|332006286|gb|AED93669.1| pentatricopeptide (PPR) repeat-containing protein [Arabidopsis thaliana] Length = 575 Score = 68.2 bits (165), Expect = 1e-09 Identities = 37/94 (39%), Positives = 58/94 (61%), Gaps = 2/94 (2%) Frame = -1 Query: 284 SVSKYSECSICSLYS--LPQRTLSTKVSQYNRKHKKSKCADGPPLTAAQTEQIVSELPPR 111 S + + S+C+ YS +P R+L ++S +RK +K P L ++ ++ +S+LPPR Sbjct: 76 SQGRLASVSMCTQYSTSVPTRSLRRRIS--SRKKSSTK----PILNESKFQETISKLPPR 129 Query: 110 FDSEDLCRTITLQKDPRACLELFKYASKQPRFRH 9 F E+L ITL++DP C LF +AS+QPRF H Sbjct: 130 FTPEELADAITLEEDPFLCFHLFNWASQQPRFTH 163 >ref|XP_006338053.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like isoform X1 [Solanum tuberosum] gi|565341791|ref|XP_006338054.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like isoform X2 [Solanum tuberosum] Length = 451 Score = 67.4 bits (163), Expect = 3e-09 Identities = 39/92 (42%), Positives = 53/92 (57%) Frame = -1 Query: 281 VSKYSECSICSLYSLPQRTLSTKVSQYNRKHKKSKCADGPPLTAAQTEQIVSELPPRFDS 102 VS YS + L P R+L R +++++ A P L +Q + VS+LPPRF Sbjct: 87 VSFYSSSAPGWLRGPPSRSLR------KRMNRRARIAAMPVLDESQFQNAVSQLPPRFTP 140 Query: 101 EDLCRTITLQKDPRACLELFKYASKQPRFRHN 6 E+L + Q+DP CLELF +ASKQ RFRHN Sbjct: 141 EELRDVMVSQRDPLVCLELFNWASKQHRFRHN 172 >ref|XP_006294242.1| hypothetical protein CARUB_v10023241mg [Capsella rubella] gi|482562950|gb|EOA27140.1| hypothetical protein CARUB_v10023241mg [Capsella rubella] Length = 437 Score = 67.4 bits (163), Expect = 3e-09 Identities = 39/92 (42%), Positives = 55/92 (59%) Frame = -1 Query: 284 SVSKYSECSICSLYSLPQRTLSTKVSQYNRKHKKSKCADGPPLTAAQTEQIVSELPPRFD 105 SVS Y + S S P R+L ++S NRK K P L ++ ++ +S+LPPRF Sbjct: 84 SVSMYIQYST----SAPTRSLRRRIS--NRKKMSMK----PVLNESKFQETISKLPPRFT 133 Query: 104 SEDLCRTITLQKDPRACLELFKYASKQPRFRH 9 E+L ITL++DP C LF +AS+QPRF+H Sbjct: 134 PEELADAITLEEDPFLCFHLFNWASQQPRFKH 165 >ref|NP_180348.2| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] gi|218546772|sp|Q9ZUY1.2|PP173_ARATH RecName: Full=Pentatricopeptide repeat-containing protein At2g27800, mitochondrial; Flags: Precursor gi|330252952|gb|AEC08046.1| pentatricopeptide repeat-containing protein [Arabidopsis thaliana] Length = 442 Score = 67.4 bits (163), Expect = 3e-09 Identities = 39/92 (42%), Positives = 55/92 (59%) Frame = -1 Query: 284 SVSKYSECSICSLYSLPQRTLSTKVSQYNRKHKKSKCADGPPLTAAQTEQIVSELPPRFD 105 SVS Y + S S+P R+L ++S NRK +K P L ++ + +S+LPPRF Sbjct: 89 SVSMYIQYST----SVPTRSLRRRIS--NRKKSSAK----PILNVSKFHETISKLPPRFT 138 Query: 104 SEDLCRTITLQKDPRACLELFKYASKQPRFRH 9 E+L ITL++DP C LF +AS+QPRF H Sbjct: 139 PEELADAITLEEDPFLCFHLFNWASQQPRFTH 170 >ref|XP_007015464.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] gi|508785827|gb|EOY33083.1| Tetratricopeptide repeat-like superfamily protein, putative [Theobroma cacao] Length = 429 Score = 67.0 bits (162), Expect = 3e-09 Identities = 31/64 (48%), Positives = 44/64 (68%) Frame = -1 Query: 197 RKHKKSKCADGPPLTAAQTEQIVSELPPRFDSEDLCRTITLQKDPRACLELFKYASKQPR 18 R +K+ K + P L + E+ VS+L PRF +E+LC ITL++DP C ELF +A +QPR Sbjct: 93 RINKRLKASSKPVLDQPKFEKAVSQLLPRFTAEELCNVITLEEDPLVCWELFNWAVQQPR 152 Query: 17 FRHN 6 FRH+ Sbjct: 153 FRHD 156 >ref|XP_006829818.1| hypothetical protein AMTR_s00119p00084460 [Amborella trichopoda] gi|548835399|gb|ERM97234.1| hypothetical protein AMTR_s00119p00084460 [Amborella trichopoda] Length = 640 Score = 66.6 bits (161), Expect = 4e-09 Identities = 34/77 (44%), Positives = 46/77 (59%) Frame = -1 Query: 236 PQRTLSTKVSQYNRKHKKSKCADGPPLTAAQTEQIVSELPPRFDSEDLCRTITLQKDPRA 57 P +T S +Y RK PL A +Q +S+LPPRF EDL ++ QKDP A Sbjct: 288 PPKTSSKFRPKYRRKMPNR------PLDLAYVQQALSQLPPRFTPEDLLHILSSQKDPLA 341 Query: 56 CLELFKYASKQPRFRHN 6 CL +F +AS+QPRF+H+ Sbjct: 342 CLHIFDWASRQPRFKHD 358 >ref|XP_004309881.1| PREDICTED: pentatricopeptide repeat-containing protein At2g27800, mitochondrial-like [Fragaria vesca subsp. vesca] Length = 441 Score = 65.9 bits (159), Expect = 7e-09 Identities = 36/89 (40%), Positives = 53/89 (59%) Frame = -1 Query: 272 YSECSICSLYSLPQRTLSTKVSQYNRKHKKSKCADGPPLTAAQTEQIVSELPPRFDSEDL 93 Y + S+ YS P R+ R++K+ + + P L AQ ++ VS+L PRF E+L Sbjct: 78 YEQFSLHKFYSSPSRSFR------RRENKRLESSRKPTLNQAQFQKSVSQLLPRFTPEEL 131 Query: 92 CRTITLQKDPRACLELFKYASKQPRFRHN 6 IT Q+DP CLELF +AS+Q RF+H+ Sbjct: 132 GDIITKQEDPLVCLELFNWASQQLRFKHD 160 >gb|EPS72326.1| hypothetical protein M569_02437, partial [Genlisea aurea] Length = 184 Score = 65.5 bits (158), Expect = 1e-08 Identities = 31/64 (48%), Positives = 44/64 (68%) Frame = -1 Query: 197 RKHKKSKCADGPPLTAAQTEQIVSELPPRFDSEDLCRTITLQKDPRACLELFKYASKQPR 18 R +K+++ A P L ++++S++P RF +EDL I LQ+DP CLELF +ASKQ R Sbjct: 22 RINKRARAAAKPLLNEPLFQKVLSQIPARFTNEDLHDVIALQEDPLVCLELFNWASKQHR 81 Query: 17 FRHN 6 FRHN Sbjct: 82 FRHN 85 >ref|XP_002879134.1| hypothetical protein ARALYDRAFT_481728 [Arabidopsis lyrata subsp. lyrata] gi|297324973|gb|EFH55393.1| hypothetical protein ARALYDRAFT_481728 [Arabidopsis lyrata subsp. lyrata] Length = 436 Score = 65.5 bits (158), Expect = 1e-08 Identities = 33/78 (42%), Positives = 50/78 (64%) Frame = -1 Query: 242 SLPQRTLSTKVSQYNRKHKKSKCADGPPLTAAQTEQIVSELPPRFDSEDLCRTITLQKDP 63 S+P R+L ++S NRK +K P L + ++ +++LPPRF E+L ITL++DP Sbjct: 93 SVPTRSLRRRIS--NRKKSSTK----PVLNEFKFQETITKLPPRFTPEELADAITLEEDP 146 Query: 62 RACLELFKYASKQPRFRH 9 C LF +AS+QPRF+H Sbjct: 147 FLCFHLFNWASQQPRFKH 164 >ref|XP_007206500.1| hypothetical protein PRUPE_ppa019170mg [Prunus persica] gi|462402142|gb|EMJ07699.1| hypothetical protein PRUPE_ppa019170mg [Prunus persica] Length = 369 Score = 65.1 bits (157), Expect = 1e-08 Identities = 30/67 (44%), Positives = 42/67 (62%) Frame = -1 Query: 203 YNRKHKKSKCADGPPLTAAQTEQIVSELPPRFDSEDLCRTITLQKDPRACLELFKYASKQ 24 + R+ K + L Q ++ +S+L PRF E+LC IT Q DP CLELF +AS+Q Sbjct: 59 FRRRENKRVKSSKSTLDEVQFQRAISQLLPRFTPEELCNVITQQDDPIVCLELFNWASQQ 118 Query: 23 PRFRHNA 3 PRF+H+A Sbjct: 119 PRFKHDA 125 >gb|AAC73020.1| hypothetical protein [Arabidopsis thaliana] Length = 427 Score = 64.3 bits (155), Expect = 2e-08 Identities = 33/77 (42%), Positives = 48/77 (62%) Frame = -1 Query: 239 LPQRTLSTKVSQYNRKHKKSKCADGPPLTAAQTEQIVSELPPRFDSEDLCRTITLQKDPR 60 +P R+L ++S NRK +K P L ++ + +S+LPPRF E+L ITL++DP Sbjct: 85 VPTRSLRRRIS--NRKKSSAK----PILNVSKFHETISKLPPRFTPEELADAITLEEDPF 138 Query: 59 ACLELFKYASKQPRFRH 9 C LF +AS+QPRF H Sbjct: 139 LCFHLFNWASQQPRFTH 155