BLASTX nr result
ID: Papaver27_contig00054681
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Papaver27_contig00054681 (407 letters) Database: ./nr 38,876,450 sequences; 13,856,398,315 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU37647.1| hypothetical protein MIMGU_mgv1a005905mg [Mimulus... 67 3e-09 ref|XP_004977049.1| PREDICTED: oryzain alpha chain-like [Setaria... 66 6e-09 gb|EYU36326.1| hypothetical protein MIMGU_mgv1a005614mg [Mimulus... 65 8e-09 ref|XP_006403303.1| hypothetical protein EUTSA_v10003205mg [Eutr... 65 8e-09 gb|AAL60579.1|AF454957_1 senescence-associated cysteine protease... 65 8e-09 dbj|BAH08632.1| daikon cysteine protease RD21 [Raphanus sativus] 65 8e-09 ref|XP_006487026.1| PREDICTED: cysteine proteinase RD21a-like [C... 65 1e-08 ref|XP_006422960.1| hypothetical protein CICLE_v10028338mg [Citr... 65 1e-08 ref|XP_006280322.1| hypothetical protein CARUB_v10026245mg, part... 65 1e-08 ref|XP_006855225.1| hypothetical protein AMTR_s00051p00208220 [A... 64 2e-08 ref|XP_007199820.1| hypothetical protein PRUPE_ppa005328mg [Prun... 64 2e-08 dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus] 64 2e-08 ref|XP_002518705.1| cysteine protease, putative [Ricinus communi... 64 2e-08 gb|AAS20467.1| cysteine protease-like protein [Pelargonium x hor... 64 2e-08 gb|ABQ10204.1| cysteine protease Cp6 [Actinidia deliciosa] 64 3e-08 ref|NP_568620.1| Granulin repeat cysteine protease family protei... 63 4e-08 gb|EPS60205.1| hypothetical protein M569_14597, partial [Genlise... 63 4e-08 ref|XP_002863697.1| hypothetical protein ARALYDRAFT_917391 [Arab... 63 4e-08 dbj|BAF01762.1| cysteine protease component of protease-inhibito... 63 4e-08 gb|EXC17258.1| Cysteine proteinase RD21a [Morus notabilis] 63 5e-08 >gb|EYU37647.1| hypothetical protein MIMGU_mgv1a005905mg [Mimulus guttatus] Length = 465 Score = 66.6 bits (161), Expect = 3e-09 Identities = 28/38 (73%), Positives = 33/38 (86%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKEAS 157 SYNQ NGGLMDYAF F+IKN GIDT+EDYPYKA++ + Sbjct: 192 SYNQGCNGGLMDYAFQFVIKNGGIDTEEDYPYKARDGT 229 >ref|XP_004977049.1| PREDICTED: oryzain alpha chain-like [Setaria italica] Length = 463 Score = 65.9 bits (159), Expect = 6e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKE 163 SYNQ NGGLMDYAF FII N GIDT+EDYPYKAK+ Sbjct: 190 SYNQGCNGGLMDYAFQFIINNGGIDTEEDYPYKAKD 225 >gb|EYU36326.1| hypothetical protein MIMGU_mgv1a005614mg [Mimulus guttatus] Length = 477 Score = 65.5 bits (158), Expect = 8e-09 Identities = 28/37 (75%), Positives = 32/37 (86%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKEA 160 SYNQ NGGLMDYAF FIIKN GID+D+DYPYK ++A Sbjct: 206 SYNQGCNGGLMDYAFQFIIKNGGIDSDQDYPYKGRDA 242 >ref|XP_006403303.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum] gi|557104416|gb|ESQ44756.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum] Length = 457 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKE 163 SYNQ NGGLMDYAF FIIKN GIDT+EDYPYKA + Sbjct: 192 SYNQGCNGGLMDYAFEFIIKNGGIDTEEDYPYKAAD 227 >gb|AAL60579.1|AF454957_1 senescence-associated cysteine protease [Brassica oleracea] Length = 460 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKE 163 SYNQ NGGLMDYAF FIIKN GIDT+EDYPYKA + Sbjct: 195 SYNQGCNGGLMDYAFEFIIKNGGIDTEEDYPYKAAD 230 >dbj|BAH08632.1| daikon cysteine protease RD21 [Raphanus sativus] Length = 289 Score = 65.5 bits (158), Expect = 8e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKE 163 SYNQ NGGLMDYAF FIIKN GIDT+EDYPYKA + Sbjct: 61 SYNQGCNGGLMDYAFEFIIKNGGIDTEEDYPYKAAD 96 >ref|XP_006487026.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis] Length = 472 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 267 YNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKEAS 157 YNQ NGGLMDYAF FIIKN GIDT+EDYPYKA + S Sbjct: 197 YNQGCNGGLMDYAFKFIIKNGGIDTEEDYPYKATDGS 233 >ref|XP_006422960.1| hypothetical protein CICLE_v10028338mg [Citrus clementina] gi|557524894|gb|ESR36200.1| hypothetical protein CICLE_v10028338mg [Citrus clementina] Length = 479 Score = 65.1 bits (157), Expect = 1e-08 Identities = 29/37 (78%), Positives = 31/37 (83%) Frame = -3 Query: 267 YNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKEAS 157 YNQ NGGLMDYAF FIIKN GIDT+EDYPYKA + S Sbjct: 204 YNQGCNGGLMDYAFKFIIKNGGIDTEEDYPYKATDGS 240 >ref|XP_006280322.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella] gi|482549026|gb|EOA13220.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella] Length = 511 Score = 64.7 bits (156), Expect = 1e-08 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKE 163 SYNQ NGGLMDYAF FIIKN GIDT++DYPYKA + Sbjct: 244 SYNQGCNGGLMDYAFEFIIKNGGIDTEQDYPYKASD 279 >ref|XP_006855225.1| hypothetical protein AMTR_s00051p00208220 [Amborella trichopoda] gi|548858978|gb|ERN16692.1| hypothetical protein AMTR_s00051p00208220 [Amborella trichopoda] Length = 538 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/37 (75%), Positives = 31/37 (83%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKEA 160 SYN NGGLMDYAF FII N GIDT+EDYPYKA++A Sbjct: 267 SYNDGCNGGLMDYAFQFIIDNGGIDTEEDYPYKARDA 303 >ref|XP_007199820.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica] gi|462395220|gb|EMJ01019.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica] Length = 466 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKEAS 157 SYNQ NGGLMDYAF FII N GIDT+EDYPY A++ S Sbjct: 193 SYNQGCNGGLMDYAFQFIINNGGIDTEEDYPYHARDGS 230 >dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus] Length = 461 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKE 163 SYNQ NGGLMDYAF FIIKN GIDT+EDYPY K+ Sbjct: 198 SYNQGCNGGLMDYAFEFIIKNGGIDTEEDYPYTGKD 233 >ref|XP_002518705.1| cysteine protease, putative [Ricinus communis] gi|223542086|gb|EEF43630.1| cysteine protease, putative [Ricinus communis] Length = 471 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKE 163 SYNQ NGGLMDYAF FII N GIDT+EDYPYKA + Sbjct: 196 SYNQGCNGGLMDYAFEFIINNGGIDTEEDYPYKASD 231 >gb|AAS20467.1| cysteine protease-like protein [Pelargonium x hortorum] Length = 234 Score = 63.9 bits (154), Expect = 2e-08 Identities = 28/38 (73%), Positives = 32/38 (84%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKEAS 157 SYNQ NGGLMDYAF FIIKN GID++EDYPYKA + + Sbjct: 38 SYNQGCNGGLMDYAFEFIIKNGGIDSEEDYPYKAVDGT 75 >gb|ABQ10204.1| cysteine protease Cp6 [Actinidia deliciosa] Length = 461 Score = 63.5 bits (153), Expect = 3e-08 Identities = 27/36 (75%), Positives = 31/36 (86%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKE 163 SYN+ NGGLMDYAF FIIKN GIDT+EDYPY A++ Sbjct: 192 SYNEGCNGGLMDYAFEFIIKNGGIDTEEDYPYNARD 227 >ref|NP_568620.1| Granulin repeat cysteine protease family protein [Arabidopsis thaliana] gi|9757832|dbj|BAB08269.1| cysteine protease component of protease-inhibitor complex [Arabidopsis thaliana] gi|17065064|gb|AAL32686.1| cysteine protease component of protease-inhibitor complex [Arabidopsis thaliana] gi|21387153|gb|AAM47980.1| cysteine protease component of protease-inhibitor complex [Arabidopsis thaliana] gi|332007522|gb|AED94905.1| Granulin repeat cysteine protease family protein [Arabidopsis thaliana] Length = 463 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKE 163 SYNQ NGGLMDYAF FIIKN GIDT+ DYPYKA + Sbjct: 196 SYNQGCNGGLMDYAFEFIIKNGGIDTEADYPYKAAD 231 >gb|EPS60205.1| hypothetical protein M569_14597, partial [Genlisea aurea] Length = 424 Score = 63.2 bits (152), Expect = 4e-08 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKEAS 157 SYNQ NGGLMDYA+ FI+KN GIDT+EDY YK ++AS Sbjct: 178 SYNQGCNGGLMDYAYEFILKNKGIDTEEDYSYKGRDAS 215 >ref|XP_002863697.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. lyrata] gi|297309532|gb|EFH39956.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. lyrata] Length = 463 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKE 163 SYNQ NGGLMDYAF FIIKN GIDT+ DYPYKA + Sbjct: 196 SYNQGCNGGLMDYAFEFIIKNGGIDTEADYPYKAAD 231 >dbj|BAF01762.1| cysteine protease component of protease-inhibitor complex [Arabidopsis thaliana] Length = 300 Score = 63.2 bits (152), Expect = 4e-08 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKE 163 SYNQ NGGLMDYAF FIIKN GIDT+ DYPYKA + Sbjct: 33 SYNQGCNGGLMDYAFEFIIKNGGIDTEADYPYKAAD 68 >gb|EXC17258.1| Cysteine proteinase RD21a [Morus notabilis] Length = 476 Score = 62.8 bits (151), Expect = 5e-08 Identities = 26/36 (72%), Positives = 30/36 (83%) Frame = -3 Query: 270 SYNQRYNGGLMDYAFHFIIKNNGIDTDEDYPYKAKE 163 SYNQ NGGLMDY F FII N G+DT+EDYPYKA++ Sbjct: 203 SYNQGCNGGLMDYGFEFIINNGGVDTEEDYPYKARD 238